Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte-specific transcript 1 protein

Gene

LST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.2 Publications

GO - Biological processi

  • anatomical structure morphogenesis Source: UniProtKB
  • cell morphogenesis Source: InterPro
  • dendrite development Source: UniProtKB
  • immune response Source: UniProtKB
  • negative regulation of lymphocyte proliferation Source: UniProtKB
  • regulation of cell shape Source: UniProtKB-KW

Keywordsi

Biological processCell shape, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte-specific transcript 1 protein
Alternative name(s):
Protein B144
Gene namesi
Name:LST1
Synonyms:B144
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000204482.10
HGNCiHGNC:14189 LST1
MIMi109170 gene
neXtProtiNX_O00453

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei8 – 28HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi7940
OpenTargetsiENSG00000204482
PharmGKBiPA37856

Polymorphism and mutation databases

BioMutaiLST1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000845071 – 97Leukocyte-specific transcript 1 proteinAdd BLAST97

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei58PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO00453
PeptideAtlasiO00453
PRIDEiO00453
TopDownProteomicsiO00453-12 [O00453-12]

PTM databases

iPTMnetiO00453
PhosphoSitePlusiO00453
SwissPalmiO00453

Expressioni

Tissue specificityi

Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.2 Publications

Inductioni

By IFNG/IFN-gamma. Up-regulated upon autoimmune and bacterially-induced inflammation.3 Publications

Gene expression databases

BgeeiENSG00000204482
CleanExiHS_LST1
ExpressionAtlasiO00453 baseline and differential
GenevisibleiO00453 HS

Interactioni

Protein-protein interaction databases

IntActiO00453, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliO00453
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the LST1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00730000112003
HOGENOMiHOG000039999
HOVERGENiHBG045577
InParanoidiO00453
OMAiACIAKNK
PhylomeDBiO00453
TreeFamiTF338533

Family and domain databases

InterProiView protein in InterPro
IPR007775 Leukocyte-sp_tscrpt_1_LST1
PANTHERiPTHR15452 PTHR15452, 1 hit
PfamiView protein in Pfam
PF05083 LST1, 1 hit
PIRSFiPIRSF037638 Leukocyte-sp_tscrpt_1_LST1, 1 hit

Sequences (13)i

Sequence statusi: Complete.

This entry describes 13 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.1 Publication
Isoform 11 Publication (identifier: O00453-1) [UniParc]FASTAAdd to basket
Also known as: LST1/A1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSRNDDICI YGGLGLGGLL LLAVVLLSAC LCWLHRRVKR LERSWAQGSS
60 70 80 90
EQELHYASLQ RLPVPSSEGP DLRGRDKRGT KEDPRADYAC IAENKPT
Length:97
Mass (Da):10,792
Last modified:September 23, 2008 - v2
Checksum:iAA03C77B5787B524
GO
Isoform 21 Publication (identifier: O00453-2) [UniParc]FASTAAdd to basket
Also known as: LST1/C1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MLSRNDDICI...RRVKRLERSW → MIYVSTGAWG...IEEHLLSWSQ

Show »
Length:91
Mass (Da):10,133
Checksum:i84A4FCD274A92DEA
GO
Isoform 31 Publication (identifier: O00453-3) [UniParc]FASTAAdd to basket
Also known as: pLst11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MLSRNDDICI...RRVKRLERSW → MIYVSTGAWGWAGSCFWQWSFCPPACVGCIEEE

Show »
Length:85
Mass (Da):9,410
Checksum:i0276676D528C49A6
GO
Isoform 41 Publication (identifier: O00453-4) [UniParc]FASTAAdd to basket
Also known as: LST1/E1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWA → MT

Show »
Length:53
Mass (Da):5,887
Checksum:i5A924968D231E74F
GO
Isoform 51 Publication (identifier: O00453-5) [UniParc]FASTAAdd to basket
Also known as: LST1/K1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     38-97: VKRLERSWAQ...YACIAENKPT → GPGLLRAGTPLCISAEAASAQQ

Show »
Length:59
Mass (Da):6,122
Checksum:iFC2FF156D576C486
GO
Isoform 61 Publication (identifier: O00453-6) [UniParc]FASTAAdd to basket
Also known as: LST1/L1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.
     46-60: Missing.

Show »
Length:51
Mass (Da):5,869
Checksum:iB5A041EAFE936EDC
GO
Isoform 71 Publication (identifier: O00453-7) [UniParc]FASTAAdd to basket
Also known as: LST1/J1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.
     46-97: AQGSSEQELH...YACIAENKPT → HLSVLVPGPGLLRAGTPLCISAEAASAQQ

Show »
Length:43
Mass (Da):4,629
Checksum:iE19730B87CE1D4B6
GO
Isoform 81 Publication (identifier: O00453-8) [UniParc]FASTAAdd to basket
Also known as: LST1/M1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-97: DICIYGGLGL...YACIAENKPT → APSVLVPGPGLLRAGTPLCISAEAASAQQ

Show »
Length:35
Mass (Da):3,492
Checksum:iB2C9F24119316035
GO
Isoform 91 Publication (identifier: O00453-9) [UniParc]FASTAAdd to basket
Also known as: LST1/N1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     7-13: DICIYGG → EAASAQQ
     14-97: Missing.

Show »
Length:13
Mass (Da):1,421
Checksum:i9E7701449EE4DB1A
GO
Isoform 10 (identifier: O00453-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.

Show »
Length:66
Mass (Da):7,498
Checksum:iF6ECD034EE4D29B1
GO
Isoform 11 (identifier: O00453-11) [UniParc]FASTAAdd to basket
Also known as: LST1/P

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: W → WHLLSWSQ

Show »
Length:104
Mass (Da):11,644
Checksum:i78F66572BADB20E3
GO
Isoform 12 (identifier: O00453-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     38-97: VKRLERSWAQ...YACIAENKPT → APSVLVPGPGLLRAGTPLCISAEAASAQQ

Note: No experimental confirmation available.
Show »
Length:66
Mass (Da):6,786
Checksum:iEAFB5CA007926ED4
GO
Isoform 13 (identifier: O00453-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-37: Missing.
     45-45: W → WHLLSWSQ

Note: No experimental confirmation available.
Show »
Length:73
Mass (Da):8,350
Checksum:iF379101B30F3A4CF
GO

Sequence cautioni

The sequence AAX45332 differs from that shown. Reason: Erroneous termination at position 47. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti21L → P in AAX45332 (PubMed:16362817).Curated1
Sequence conflicti46A → T in AAB86999 (PubMed:9367684).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0505771 – 46MLSRN…ERSWA → MT in isoform 4. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0505781 – 45MLSRN…LERSW → MIYVSTGAWGWAGSCFWQWS FCPPACVGCIEEHLLSWSQ in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0505791 – 45MLSRN…LERSW → MIYVSTGAWGWAGSCFWQWS FCPPACVGCIEEE in isoform 3. CuratedAdd BLAST45
Alternative sequenceiVSP_0505807 – 97DICIY…ENKPT → APSVLVPGPGLLRAGTPLCI SAEAASAQQ in isoform 8. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_0505837 – 37Missing in isoform 6, isoform 7, isoform 10 and isoform 13. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_0505817 – 13DICIYGG → EAASAQQ in isoform 9. 1 Publication7
Alternative sequenceiVSP_05058214 – 97Missing in isoform 9. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_04736738 – 97VKRLE…ENKPT → APSVLVPGPGLLRAGTPLCI SAEAASAQQ in isoform 12. CuratedAdd BLAST60
Alternative sequenceiVSP_05058438 – 97VKRLE…ENKPT → GPGLLRAGTPLCISAEAASA QQ in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_04645945W → WHLLSWSQ in isoform 11 and isoform 13. 1 Publication1
Alternative sequenceiVSP_05058646 – 97AQGSS…ENKPT → HLSVLVPGPGLLRAGTPLCI SAEAASAQQ in isoform 7. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_05058746 – 60Missing in isoform 6. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U00921 Genomic DNA Translation: AAB57724.1
AF000424 mRNA Translation: AAB86998.1
AF000425 mRNA Translation: AAB86999.1
AF000426 mRNA Translation: AAB87000.1
Y18486 mRNA Translation: CAB59904.1
Y18487 mRNA Translation: CAB59905.1
Y18488 mRNA Translation: CAB60038.1
Y18489 mRNA Translation: CAB59906.1
Y18490 mRNA Translation: CAB59903.1
AF129756 Genomic DNA Translation: AAD18090.1
BA000025 Genomic DNA Translation: BAB63394.1
AL662847 Genomic DNA Translation: CAI17681.1
AL662847 Genomic DNA Translation: CAI17682.1
AL662847 Genomic DNA Translation: CAI17684.1
AL662847 Genomic DNA Translation: CAI17687.1
AL662801 Genomic DNA Translation: CAI18295.1
AL662801 Genomic DNA Translation: CAI18296.1
AL662801 Genomic DNA Translation: CAI18298.2
AL662801 Genomic DNA Translation: CAI18299.1
AL662801 Genomic DNA Translation: CAI18300.1
AL929587 Genomic DNA Translation: CAI18653.1
AL929587 Genomic DNA Translation: CAI18654.1
AL929587 Genomic DNA Translation: CAI18655.1
AL929587 Genomic DNA Translation: CAI18658.1
AL929587 Genomic DNA Translation: CAI18659.2
AL929587 Genomic DNA Translation: CAM45790.1
BX248519 Genomic DNA Translation: CAI41945.1
BX248519 Genomic DNA Translation: CAI41946.1
BX248519 Genomic DNA Translation: CAI41949.1
BX248519 Genomic DNA Translation: CAI41950.1
BX248519 Genomic DNA Translation: CAI41952.1
BX248519 Genomic DNA Translation: CAM26060.1
AL662847 Genomic DNA Translation: CAO72097.1
CR753892 Genomic DNA Translation: CAQ06939.1
CR753892 Genomic DNA Translation: CAQ06940.1
CR753892 Genomic DNA Translation: CAQ06943.1
CR753892 Genomic DNA Translation: CAQ06944.1
CR753892 Genomic DNA Translation: CAQ06946.1
CR753892 Genomic DNA Translation: CAQ06947.1
CR759886 Genomic DNA Translation: CAQ07231.1
CR759886 Genomic DNA Translation: CAQ07232.1
CR759886 Genomic DNA Translation: CAQ07235.1
CR759886 Genomic DNA Translation: CAQ07236.1
CR759886 Genomic DNA Translation: CAQ07238.1
CR759886 Genomic DNA Translation: CAQ07239.1
CR942185 Genomic DNA Translation: CAQ07715.1
CR942185 Genomic DNA Translation: CAQ07716.1
CR942185 Genomic DNA Translation: CAQ07719.1
CR942185 Genomic DNA Translation: CAQ07720.1
CR942185 Genomic DNA Translation: CAQ07722.1
CR942185 Genomic DNA Translation: CAQ07723.1
BX927320 Genomic DNA Translation: CAQ09997.1
BX927320 Genomic DNA Translation: CAQ09998.1
BX927320 Genomic DNA Translation: CAQ10001.1
BX927320 Genomic DNA Translation: CAQ10002.1
BX927320 Genomic DNA Translation: CAQ10004.1
BX927320 Genomic DNA Translation: CAQ10005.1
CH471081 Genomic DNA Translation: EAX03427.1
CH471081 Genomic DNA Translation: EAX03431.1
BC103855 mRNA Translation: AAI03856.1
BC103856 mRNA Translation: AAI03857.1
AY852266 mRNA Translation: AAX45332.1 Sequence problems.
CCDSiCCDS43450.2 [O00453-1]
CCDS4705.2 [O00453-10]
CCDS54984.1 [O00453-11]
CCDS54985.1 [O00453-12]
CCDS54986.1 [O00453-5]
CCDS54987.1 [O00453-13]
RefSeqiNP_001160010.1, NM_001166538.1 [O00453-13]
NP_009092.3, NM_007161.3 [O00453-11]
NP_995309.2, NM_205837.2 [O00453-12]
NP_995310.2, NM_205838.2 [O00453-10]
NP_995311.2, NM_205839.2 [O00453-1]
NP_995312.2, NM_205840.2 [O00453-5]
XP_006715269.1, XM_006715206.3 [O00453-11]
XP_006715272.1, XM_006715209.3 [O00453-13]
XP_006715273.1, XM_006715210.3 [O00453-5]
XP_011513216.1, XM_011514914.2 [O00453-11]
UniGeneiHs.436066

Genome annotation databases

EnsembliENST00000303757; ENSP00000303649; ENSG00000204482 [O00453-5]
ENST00000339530; ENSP00000339201; ENSG00000204482 [O00453-12]
ENST00000376086; ENSP00000365254; ENSG00000204482 [O00453-13]
ENST00000376089; ENSP00000365257; ENSG00000204482 [O00453-10]
ENST00000376092; ENSP00000365260; ENSG00000204482 [O00453-8]
ENST00000376093; ENSP00000365261; ENSG00000204482 [O00453-11]
ENST00000376096; ENSP00000365264; ENSG00000204482 [O00453-9]
ENST00000376110; ENSP00000365278; ENSG00000204482 [O00453-6]
ENST00000383480; ENSP00000372972; ENSG00000206433 [O00453-13]
ENST00000383482; ENSP00000372974; ENSG00000206433 [O00453-8]
ENST00000383484; ENSP00000372976; ENSG00000206433 [O00453-12]
ENST00000383486; ENSP00000372978; ENSG00000206433 [O00453-11]
ENST00000400250; ENSP00000383109; ENSG00000206433 [O00453-5]
ENST00000400257; ENSP00000383116; ENSG00000206433 [O00453-9]
ENST00000400262; ENSP00000383121; ENSG00000206433 [O00453-10]
ENST00000400263; ENSP00000383122; ENSG00000206433 [O00453-10]
ENST00000400264; ENSP00000383123; ENSG00000206433 [O00453-1]
ENST00000400265; ENSP00000383124; ENSG00000206433 [O00453-6]
ENST00000411490; ENSP00000395409; ENSG00000235915 [O00453-1]
ENST00000412041; ENSP00000399411; ENSG00000231048 [O00453-11]
ENST00000412623; ENSP00000409229; ENSG00000226182 [O00453-11]
ENST00000413426; ENSP00000408876; ENSG00000231048 [O00453-9]
ENST00000414266; ENSP00000402707; ENSG00000223465 [O00453-10]
ENST00000415419; ENSP00000415143; ENSG00000235915 [O00453-6]
ENST00000415490; ENSP00000390658; ENSG00000234514 [O00453-8]
ENST00000415781; ENSP00000401655; ENSG00000226182 [O00453-9]
ENST00000417428; ENSP00000394614; ENSG00000223465 [O00453-1]
ENST00000418507; ENSP00000405900; ENSG00000204482 [O00453-10]
ENST00000420157; ENSP00000398700; ENSG00000226182 [O00453-10]
ENST00000420333; ENSP00000411547; ENSG00000230791 [O00453-5]
ENST00000420676; ENSP00000414246; ENSG00000226182 [O00453-13]
ENST00000420785; ENSP00000393345; ENSG00000234514 [O00453-12]
ENST00000420797; ENSP00000390587; ENSG00000235915 [O00453-10]
ENST00000422035; ENSP00000396431; ENSG00000226182 [O00453-6]
ENST00000422533; ENSP00000412627; ENSG00000226182 [O00453-5]
ENST00000423107; ENSP00000406438; ENSG00000234514 [O00453-10]
ENST00000423871; ENSP00000400069; ENSG00000223465 [O00453-6]
ENST00000425760; ENSP00000409698; ENSG00000231048 [O00453-8]
ENST00000426938; ENSP00000404051; ENSG00000234514 [O00453-1]
ENST00000427186; ENSP00000399439; ENSG00000235915 [O00453-8]
ENST00000427507; ENSP00000416283; ENSG00000223465 [O00453-1]
ENST00000428227; ENSP00000413526; ENSG00000234514 [O00453-10]
ENST00000428405; ENSP00000391963; ENSG00000230791 [O00453-10]
ENST00000428898; ENSP00000389694; ENSG00000230791 [O00453-9]
ENST00000429874; ENSP00000387560; ENSG00000230791 [O00453-1]
ENST00000429910; ENSP00000399063; ENSG00000223465 [O00453-5]
ENST00000430632; ENSP00000392949; ENSG00000231048 [O00453-1]
ENST00000430680; ENSP00000398918; ENSG00000235915 [O00453-12]
ENST00000430997; ENSP00000389795; ENSG00000235915 [O00453-5]
ENST00000432009; ENSP00000409433; ENSG00000226182 [O00453-10]
ENST00000432164; ENSP00000394834; ENSG00000223465 [O00453-8]
ENST00000433004; ENSP00000390430; ENSG00000226182 [O00453-10]
ENST00000433305; ENSP00000407417; ENSG00000230791 [O00453-8]
ENST00000433676; ENSP00000411866; ENSG00000235915 [O00453-10]
ENST00000434314; ENSP00000414173; ENSG00000226182 [O00453-1]
ENST00000436037; ENSP00000398685; ENSG00000234514 [O00453-11]
ENST00000436185; ENSP00000396579; ENSG00000235915 [O00453-10]
ENST00000437137; ENSP00000412276; ENSG00000231048 [O00453-1]
ENST00000437436; ENSP00000394891; ENSG00000231048 [O00453-6]
ENST00000437812; ENSP00000396179; ENSG00000223465 [O00453-11]
ENST00000438075; ENSP00000391929; ENSG00000204482 [O00453-1]
ENST00000438335; ENSP00000403097; ENSG00000235915 [O00453-11]
ENST00000438349; ENSP00000391057; ENSG00000234514 [O00453-6]
ENST00000438381; ENSP00000393282; ENSG00000230791 [O00453-12]
ENST00000440242; ENSP00000394815; ENSG00000223465 [O00453-13]
ENST00000440253; ENSP00000396235; ENSG00000223465 [O00453-10]
ENST00000440323; ENSP00000414744; ENSG00000231048 [O00453-10]
ENST00000440328; ENSP00000401516; ENSG00000226182 [O00453-8]
ENST00000442052; ENSP00000399474; ENSG00000226182 [O00453-12]
ENST00000443340; ENSP00000396533; ENSG00000206433 [O00453-1]
ENST00000443655; ENSP00000411961; ENSG00000231048 [O00453-5]
ENST00000443741; ENSP00000388956; ENSG00000235915 [O00453-1]
ENST00000446239; ENSP00000402873; ENSG00000230791 [O00453-6]
ENST00000447141; ENSP00000397826; ENSG00000235915 [O00453-9]
ENST00000447391; ENSP00000411087; ENSG00000230791 [O00453-10]
ENST00000448236; ENSP00000406455; ENSG00000230791 [O00453-11]
ENST00000448441; ENSP00000409008; ENSG00000206433 [O00453-10]
ENST00000449236; ENSP00000391420; ENSG00000231048 [O00453-10]
ENST00000449273; ENSP00000415623; ENSG00000234514 [O00453-5]
ENST00000450291; ENSP00000404500; ENSG00000230791 [O00453-13]
ENST00000450425; ENSP00000415168; ENSG00000223465 [O00453-10]
ENST00000451641; ENSP00000406625; ENSG00000223465 [O00453-12]
ENST00000451922; ENSP00000401567; ENSG00000231048 [O00453-13]
ENST00000452169; ENSP00000416808; ENSG00000231048 [O00453-12]
ENST00000453995; ENSP00000409163; ENSG00000230791 [O00453-1]
ENST00000454168; ENSP00000396004; ENSG00000234514 [O00453-13]
ENST00000455003; ENSP00000396181; ENSG00000226182 [O00453-1]
ENST00000455052; ENSP00000398228; ENSG00000234514 [O00453-10]
ENST00000455426; ENSP00000398780; ENSG00000231048 [O00453-10]
ENST00000455493; ENSP00000401650; ENSG00000223465 [O00453-9]
ENST00000455655; ENSP00000415526; ENSG00000230791 [O00453-10]
ENST00000455901; ENSP00000396378; ENSG00000234514 [O00453-1]
ENST00000457549; ENSP00000390885; ENSG00000235915 [O00453-13]
ENST00000458456; ENSP00000405920; ENSG00000234514 [O00453-9]
GeneIDi7940
KEGGihsa:7940
UCSCiuc021yus.1 human [O00453-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLST1_HUMAN
AccessioniPrimary (citable) accession number: O00453
Secondary accession number(s): B0S8E0
, B0S8E1, B0S8E5, O00452, O00454, Q13669, Q2HNT3, Q5HYS9, Q5SP24, Q5STA5, Q5STA6, Q5STA7, Q5STA8, Q5STW6, Q9UJR5, Q9UJR6, Q9UJR7, Q9UJR8, Q9UJS1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 22, 2003
Last sequence update: September 23, 2008
Last modified: May 23, 2018
This is version 145 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health