Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cGMP-dependent 3',5'-cyclic phosphodiesterase

Gene

PDE2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
Isoform PDE2A2: Regulates Mitochondrial cAMP Levels and Respiration.

Catalytic activityi

Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei431cGMPBy similarity1
Binding sitei446cGMPBy similarity1
Binding sitei499cGMPBy similarity1
Active sitei656Proton donorBy similarity1
Metal bindingi660Divalent metal cation 11
Metal bindingi696Divalent metal cation 11
Metal bindingi697Divalent metal cation 11
Metal bindingi697Divalent metal cation 21
Binding sitei697Substrate1
Metal bindingi808Divalent metal cation 11
Binding sitei808Substrate1

GO - Molecular functioni

  • 3',5'-cyclic-AMP phosphodiesterase activity Source: Reactome
  • 3',5'-cyclic-GMP phosphodiesterase activity Source: Reactome
  • calcium channel activity Source: UniProtKB
  • cAMP binding Source: UniProtKB
  • cGMP binding Source: UniProtKB
  • cGMP-stimulated cyclic-nucleotide phosphodiesterase activity Source: UniProtKB
  • cyclic-nucleotide phosphodiesterase activity Source: UniProtKB
  • drug binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • protein homodimerization activity Source: UniProtKB
  • TPR domain binding Source: UniProtKB

GO - Biological processi

  • cAMP catabolic process Source: UniProtKB
  • cAMP-mediated signaling Source: UniProtKB
  • cellular response to cGMP Source: UniProtKB
  • cellular response to drug Source: UniProtKB
  • cellular response to granulocyte macrophage colony-stimulating factor stimulus Source: UniProtKB
  • cellular response to macrophage colony-stimulating factor stimulus Source: UniProtKB
  • cellular response to mechanical stimulus Source: UniProtKB
  • cellular response to transforming growth factor beta stimulus Source: UniProtKB
  • cGMP catabolic process Source: UniProtKB
  • cGMP-mediated signaling Source: UniProtKB
  • establishment of endothelial barrier Source: UniProtKB
  • metabolic process Source: UniProtKB
  • monocyte differentiation Source: UniProtKB
  • negative regulation of cAMP biosynthetic process Source: UniProtKB
  • negative regulation of protein import into nucleus, translocation Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • negative regulation of vascular permeability Source: UniProtKB
  • positive regulation of inflammatory response Source: UniProtKB
  • positive regulation of vascular permeability Source: UniProtKB
  • protein targeting to mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, cGMP, cGMP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS10579-MONOMER.
BRENDAi3.1.4.17. 2681.
ReactomeiR-HSA-418457. cGMP effects.
R-HSA-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
cGMP-dependent 3',5'-cyclic phosphodiesterase (EC:3.1.4.17)
Alternative name(s):
Cyclic GMP-stimulated phosphodiesterase
Short name:
CGS-PDE
Short name:
cGSPDE
Gene namesi
Name:PDE2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:8777. PDE2A.

Subcellular locationi

Isoform PDE2A3 :
Isoform PDE2A2 :
Isoform PDE2A1 :

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: UniProtKB
  • endoplasmic reticulum Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • mitochondrial matrix Source: UniProtKB
  • nucleus Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB
  • plasma membrane Source: UniProtKB
  • presynaptic membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi5138.
OpenTargetsiENSG00000186642.
PharmGKBiPA33125.

Chemistry databases

ChEMBLiCHEMBL2652.
DrugBankiDB00201. Caffeine.
DB08811. Tofisopam.
GuidetoPHARMACOLOGYi1297.

Polymorphism and mutation databases

BioMutaiPDE2A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00001987962 – 941cGMP-dependent 3',5'-cyclic phosphodiesteraseAdd BLAST940

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine2 Publications1
Lipidationi5S-palmitoyl cysteine; in isoform PDE2A31 Publication1
Lipidationi11S-palmitoyl cysteine; in isoform PDE2A31 Publication1

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

MaxQBiO00408.
PaxDbiO00408.
PeptideAtlasiO00408.
PRIDEiO00408.

PTM databases

iPTMnetiO00408.
PhosphoSitePlusiO00408.

Expressioni

Tissue specificityi

Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.

Gene expression databases

BgeeiENSG00000186642.
CleanExiHS_PDE2A.
ExpressionAtlasiO00408. baseline and differential.
GenevisibleiO00408. HS.

Organism-specific databases

HPAiCAB009752.
HPA031192.

Interactioni

Subunit structurei

Homodimer.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AIPO001706EBI-1785967,EBI-704197

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB
  • TPR domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111164. 3 interactors.
DIPiDIP-40269N.
IntActiO00408. 3 interactors.
STRINGi9606.ENSP00000334910.

Chemistry databases

BindingDBiO00408.

Structurei

Secondary structure

1941
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi226 – 236Combined sources11
Helixi242 – 256Combined sources15
Beta strandi262 – 267Combined sources6
Beta strandi271 – 279Combined sources9
Beta strandi282 – 291Combined sources10
Beta strandi294 – 296Combined sources3
Helixi297 – 302Combined sources6
Helixi308 – 310Combined sources3
Helixi313 – 323Combined sources11
Beta strandi330 – 336Combined sources7
Beta strandi338 – 340Combined sources3
Beta strandi342 – 355Combined sources14
Helixi362 – 403Combined sources42
Turni410 – 412Combined sources3
Helixi413 – 425Combined sources13
Beta strandi427 – 435Combined sources9
Beta strandi437 – 443Combined sources7
Beta strandi446 – 448Combined sources3
Beta strandi456 – 460Combined sources5
Helixi464 – 472Combined sources9
Beta strandi476 – 479Combined sources4
Beta strandi502 – 506Combined sources5
Beta strandi510 – 512Combined sources3
Beta strandi516 – 528Combined sources13
Turni531 – 534Combined sources4
Helixi535 – 570Combined sources36
Turni571 – 573Combined sources3
Helixi580 – 587Combined sources8
Helixi593 – 595Combined sources3
Turni598 – 601Combined sources4
Helixi607 – 609Combined sources3
Helixi612 – 614Combined sources3
Helixi615 – 625Combined sources11
Helixi628 – 631Combined sources4
Helixi636 – 648Combined sources13
Beta strandi654 – 657Combined sources4
Helixi658 – 675Combined sources18
Helixi677 – 679Combined sources3
Helixi683 – 695Combined sources13
Turni696 – 699Combined sources4
Helixi705 – 710Combined sources6
Helixi714 – 719Combined sources6
Turni720 – 722Combined sources3
Helixi725 – 738Combined sources14
Turni741 – 743Combined sources3
Turni745 – 748Combined sources4
Helixi751 – 766Combined sources16
Helixi770 – 786Combined sources17
Helixi793 – 808Combined sources16
Helixi810 – 813Combined sources4
Helixi816 – 839Combined sources24
Helixi846 – 848Combined sources3
Turni850 – 852Combined sources3
Helixi855 – 865Combined sources11
Helixi867 – 877Combined sources11
Helixi879 – 881Combined sources3
Helixi882 – 898Combined sources17
Helixi899 – 902Combined sources4
Beta strandi904 – 906Combined sources3
Helixi914 – 916Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Z1LX-ray1.70A578-919[»]
3IBJX-ray3.02A/B215-900[»]
3ITMX-ray2.49A/B/C/D579-919[»]
3ITUX-ray1.58A/B/C/D579-919[»]
4C1IX-ray2.40A/B/C/D578-921[»]
4D08X-ray1.90A/B/C/D578-921[»]
4D09X-ray2.50A/B/C/D578-921[»]
4HTXX-ray1.90A/B/C/D578-919[»]
4HTZX-ray2.00A/B/C/D578-919[»]
4JIBX-ray1.72A/B/C/D579-919[»]
ProteinModelPortaliO00408.
SMRiO00408.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00408.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini241 – 377GAF 1Add BLAST137
Domaini409 – 548GAF 2Add BLAST140

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni633 – 891CatalyticBy similarityAdd BLAST259
Regioni656 – 660Substrate binding5

Domaini

GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.By similarity

Sequence similaritiesi

Contains 2 GAF domains.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3689. Eukaryota.
ENOG410XRI7. LUCA.
GeneTreeiENSGT00760000119066.
HOGENOMiHOG000007068.
HOVERGENiHBG053540.
KOiK18283.
OMAiNEEWSLQ.
OrthoDBiEOG091G0L2F.
PhylomeDBiO00408.
TreeFamiTF316499.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
3.30.450.40. 2 hits.
InterProiIPR003018. GAF.
IPR029016. GAF_dom-like.
IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF01590. GAF. 1 hit.
PF13185. GAF_2. 1 hit.
PF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00065. GAF. 2 hits.
SM00471. HDc. 1 hit.
[Graphical view]
SUPFAMiSSF55781. SSF55781. 3 hits.
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Experimental confirmation may be lacking for some isoforms.
Isoform PDE2A3 (identifier: O00408-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGQACGHSIL CRSQQYPAAR PAEPRGQQVF LKPDEPPPPP QPCADSLQDA
60 70 80 90 100
LLSLGSVIDI SGLQRAVKEA LSAVLPRVET VYTYLLDGES QLVCEDPPHE
110 120 130 140 150
LPQEGKVREA IISQKRLGCN GLGFSDLPGK PLARLVAPLA PDTQVLVMPL
160 170 180 190 200
ADKEAGAVAA VILVHCGQLS DNEEWSLQAV EKHTLVALRR VQVLQQRGPR
210 220 230 240 250
EAPRAVQNPP EGTAEDQKGG AAYTDRDRKI LQLCGELYDL DASSLQLKVL
260 270 280 290 300
QYLQQETRAS RCCLLLVSED NLQLSCKVIG DKVLGEEVSF PLTGCLGQVV
310 320 330 340 350
EDKKSIQLKD LTSEDVQQLQ SMLGCELQAM LCVPVISRAT DQVVALACAF
360 370 380 390 400
NKLEGDLFTD EDEHVIQHCF HYTSTVLTST LAFQKEQKLK CECQALLQVA
410 420 430 440 450
KNLFTHLDDV SVLLQEIITE ARNLSNAEIC SVFLLDQNEL VAKVFDGGVV
460 470 480 490 500
DDESYEIRIP ADQGIAGHVA TTGQILNIPD AYAHPLFYRG VDDSTGFRTR
510 520 530 540 550
NILCFPIKNE NQEVIGVAEL VNKINGPWFS KFDEDLATAF SIYCGISIAH
560 570 580 590 600
SLLYKKVNEA QYRSHLANEM MMYHMKVSDD EYTKLLHDGI QPVAAIDSNF
610 620 630 640 650
ASFTYTPRSL PEDDTSMAIL SMLQDMNFIN NYKIDCPTLA RFCLMVKKGY
660 670 680 690 700
RDPPYHNWMH AFSVSHFCYL LYKNLELTNY LEDIEIFALF ISCMCHDLDH
710 720 730 740 750
RGTNNSFQVA SKSVLAALYS SEGSVMERHH FAQAIAILNT HGCNIFDHFS
760 770 780 790 800
RKDYQRMLDL MRDIILATDL AHHLRIFKDL QKMAEVGYDR NNKQHHRLLL
810 820 830 840 850
CLLMTSCDLS DQTKGWKTTR KIAELIYKEF FSQGDLEKAM GNRPMEMMDR
860 870 880 890 900
EKAYIPELQI SFMEHIAMPI YKLLQDLFPK AAELYERVAS NREHWTKVSH
910 920 930 940
KFTIRGLPSN NSLDFLDEEY EVPDLDGTRA PINGCCSLDA E
Length:941
Mass (Da):105,717
Last modified:July 1, 1997 - v1
Checksum:i9797609B487FD64E
GO
Isoform PDE2A1 (identifier: O00408-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQ → MRRQPAASLDPLAKEPGPPGSRDDRLE

Note: Soluble form.
Show »
Length:920
Mass (Da):103,478
Checksum:iCF77ED12741349C0
GO
Isoform PDE2A2 (identifier: O00408-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MVLVLHHILIAVVQFLR

Note: Contains a transit peptide at positions 1-17.
Show »
Length:934
Mass (Da):105,147
Checksum:i2C1E4885AD13F504
GO
Isoform PDE2A4 (identifier: O00408-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MKKQRIQEGKSLAHR

Show »
Length:932
Mass (Da):104,955
Checksum:i9F5CE92BA3C2E2E5
GO
Isoform 5 (identifier: O00408-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MGQACGHSILCRSQQYPAARPAEP → MVLVLHHILIAVVQFLR
     109-357: Missing.

Note: No experimental confirmation available.
Show »
Length:685
Mass (Da):78,177
Checksum:iA6087394B98221C3
GO
Isoform 6 (identifier: O00408-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQ → MRRQPAASLDPLAKEPGPPGSRDDRLE
     750-807: SRKDYQRMLD...LLLCLLMTSC → PLRTTTILMV...DPRTGRQAQV
     808-941: Missing.

Note: No experimental confirmation available.
Show »
Length:786
Mass (Da):87,235
Checksum:i33190E63C6351001
GO

Sequence cautioni

The sequence AAS75515 differs from that shown. Reason: Frameshift at position 48.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38P → L in AAS75513 (Ref. 2) Curated1
Sequence conflicti99H → R in BAG35343 (PubMed:14702039).Curated1
Sequence conflicti213T → A in AAS75513 (Ref. 2) Curated1
Sequence conflicti664V → A in AAS75513 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024170224T → I.Corresponds to variant rs341047dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0553151 – 48MGQAC…ADSLQ → MRRQPAASLDPLAKEPGPPG SRDDRLE in isoform PDE2A1 and isoform 6. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_0553161 – 24MGQAC…RPAEP → MVLVLHHILIAVVQFLR in isoform PDE2A2 and isoform 5. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_0553171 – 24MGQAC…RPAEP → MKKQRIQEGKSLAHR in isoform PDE2A4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_055318109 – 357Missing in isoform 5. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_055319750 – 807SRKDY…LMTSC → PLRTTTILMVGLGPGGYRGP RKKLPEGQLSALQRGALGRS RMGLMGRRDPRTGRQAQV in isoform 6. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_055320808 – 941Missing in isoform 6. 1 PublicationAdd BLAST134

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U67733 mRNA. Translation: AAC51320.1.
AY495087 mRNA. Translation: AAS75513.1.
AY495088 mRNA. Translation: AAS75514.1.
AY495089 mRNA. Translation: AAS75515.1. Frameshift.
AK092278 mRNA. Translation: BAG52517.1.
AK131525 mRNA. Translation: BAD18664.1.
AK312434 mRNA. Translation: BAG35343.1.
AP003065 Genomic DNA. No translation available.
AP005019 Genomic DNA. No translation available.
CCDSiCCDS44670.1. [O00408-3]
CCDS53678.1. [O00408-4]
CCDS73345.1. [O00408-2]
CCDS8216.1. [O00408-1]
RefSeqiNP_001137311.1. NM_001143839.3. [O00408-3]
NP_001139681.1. NM_001146209.2. [O00408-4]
NP_001230713.1. NM_001243784.1. [O00408-2]
NP_002590.1. NM_002599.4. [O00408-1]
UniGeneiHs.503163.

Genome annotation databases

EnsembliENST00000334456; ENSP00000334910; ENSG00000186642. [O00408-1]
ENST00000376450; ENSP00000365633; ENSG00000186642. [O00408-5]
ENST00000444035; ENSP00000411657; ENSG00000186642. [O00408-2]
ENST00000540345; ENSP00000446399; ENSG00000186642. [O00408-4]
ENST00000544570; ENSP00000442256; ENSG00000186642. [O00408-3]
GeneIDi5138.
KEGGihsa:5138.
UCSCiuc001osn.4. human. [O00408-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U67733 mRNA. Translation: AAC51320.1.
AY495087 mRNA. Translation: AAS75513.1.
AY495088 mRNA. Translation: AAS75514.1.
AY495089 mRNA. Translation: AAS75515.1. Frameshift.
AK092278 mRNA. Translation: BAG52517.1.
AK131525 mRNA. Translation: BAD18664.1.
AK312434 mRNA. Translation: BAG35343.1.
AP003065 Genomic DNA. No translation available.
AP005019 Genomic DNA. No translation available.
CCDSiCCDS44670.1. [O00408-3]
CCDS53678.1. [O00408-4]
CCDS73345.1. [O00408-2]
CCDS8216.1. [O00408-1]
RefSeqiNP_001137311.1. NM_001143839.3. [O00408-3]
NP_001139681.1. NM_001146209.2. [O00408-4]
NP_001230713.1. NM_001243784.1. [O00408-2]
NP_002590.1. NM_002599.4. [O00408-1]
UniGeneiHs.503163.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Z1LX-ray1.70A578-919[»]
3IBJX-ray3.02A/B215-900[»]
3ITMX-ray2.49A/B/C/D579-919[»]
3ITUX-ray1.58A/B/C/D579-919[»]
4C1IX-ray2.40A/B/C/D578-921[»]
4D08X-ray1.90A/B/C/D578-921[»]
4D09X-ray2.50A/B/C/D578-921[»]
4HTXX-ray1.90A/B/C/D578-919[»]
4HTZX-ray2.00A/B/C/D578-919[»]
4JIBX-ray1.72A/B/C/D579-919[»]
ProteinModelPortaliO00408.
SMRiO00408.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111164. 3 interactors.
DIPiDIP-40269N.
IntActiO00408. 3 interactors.
STRINGi9606.ENSP00000334910.

Chemistry databases

BindingDBiO00408.
ChEMBLiCHEMBL2652.
DrugBankiDB00201. Caffeine.
DB08811. Tofisopam.
GuidetoPHARMACOLOGYi1297.

PTM databases

iPTMnetiO00408.
PhosphoSitePlusiO00408.

Polymorphism and mutation databases

BioMutaiPDE2A.

Proteomic databases

MaxQBiO00408.
PaxDbiO00408.
PeptideAtlasiO00408.
PRIDEiO00408.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334456; ENSP00000334910; ENSG00000186642. [O00408-1]
ENST00000376450; ENSP00000365633; ENSG00000186642. [O00408-5]
ENST00000444035; ENSP00000411657; ENSG00000186642. [O00408-2]
ENST00000540345; ENSP00000446399; ENSG00000186642. [O00408-4]
ENST00000544570; ENSP00000442256; ENSG00000186642. [O00408-3]
GeneIDi5138.
KEGGihsa:5138.
UCSCiuc001osn.4. human. [O00408-1]

Organism-specific databases

CTDi5138.
DisGeNETi5138.
GeneCardsiPDE2A.
HGNCiHGNC:8777. PDE2A.
HPAiCAB009752.
HPA031192.
MIMi602658. gene.
neXtProtiNX_O00408.
OpenTargetsiENSG00000186642.
PharmGKBiPA33125.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3689. Eukaryota.
ENOG410XRI7. LUCA.
GeneTreeiENSGT00760000119066.
HOGENOMiHOG000007068.
HOVERGENiHBG053540.
KOiK18283.
OMAiNEEWSLQ.
OrthoDBiEOG091G0L2F.
PhylomeDBiO00408.
TreeFamiTF316499.

Enzyme and pathway databases

BioCyciZFISH:HS10579-MONOMER.
BRENDAi3.1.4.17. 2681.
ReactomeiR-HSA-418457. cGMP effects.
R-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSiPDE2A. human.
EvolutionaryTraceiO00408.
GeneWikiiPDE2A.
GenomeRNAii5138.
PROiO00408.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186642.
CleanExiHS_PDE2A.
ExpressionAtlasiO00408. baseline and differential.
GenevisibleiO00408. HS.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
3.30.450.40. 2 hits.
InterProiIPR003018. GAF.
IPR029016. GAF_dom-like.
IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF01590. GAF. 1 hit.
PF13185. GAF_2. 1 hit.
PF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00065. GAF. 2 hits.
SM00471. HDc. 1 hit.
[Graphical view]
SUPFAMiSSF55781. SSF55781. 3 hits.
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPDE2A_HUMAN
AccessioniPrimary (citable) accession number: O00408
Secondary accession number(s): B2R646
, B3KRV5, E9PGI1, F6W5Z0, Q5J791, Q5J792, Q5J793, Q6ZMR1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 1, 1997
Last modified: November 2, 2016
This is version 148 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

cGMP binds at an allosteric activator site.By similarity

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.