Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O00338 (ST1C2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 136. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sulfotransferase 1C2

Short name=ST1C2
EC=2.8.2.-
Alternative name(s):
Sulfotransferase 1C1
Short name=SULT1C#1
humSULTC2
Gene names
Name:SULT1C2
Synonyms:SULT1C1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length296 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).

Subcellular location

Cytoplasm.

Tissue specificity

Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.

Sequence similarities

Belongs to the sulfotransferase 1 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Short (identifier: O00338-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Long (identifier: O00338-2)

The sequence of this isoform differs from the canonical sequence as follows:
     93-113: GVEKAKAMPSPRILKTHLSTQ → ETGFHHVAQAGLKLLSSSNPPASTSQSAKITD

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 296296Sulfotransferase 1C2
PRO_0000085132

Regions

Nucleotide binding49 – 546PAPS
Nucleotide binding228 – 2336PAPS
Nucleotide binding256 – 2605PAPS
Region107 – 1093Substrate binding By similarity

Sites

Active site1091Proton acceptor By similarity
Binding site1311PAPS
Binding site1391PAPS
Binding site1941PAPS

Natural variations

Alternative sequence93 – 11321GVEKA…HLSTQ → ETGFHHVAQAGLKLLSSSNP PASTSQSAKITD in isoform Long.
VSP_006303
Natural variant1281Y → H.
Corresponds to variant rs17036091 [ dbSNP | Ensembl ].
VAR_021986
Natural variant2551S → A.
Corresponds to variant rs17036104 [ dbSNP | Ensembl ].
VAR_021987
Natural variant2821R → T.
Corresponds to variant rs45515691 [ dbSNP | Ensembl ].
VAR_061888

Secondary structure

.......................................... 296
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform Short [UniParc].

Last modified July 1, 1997. Version 1.
Checksum: 3DC01C8A8ED61EFD

FASTA29634,880
        10         20         30         40         50         60 
MALTSDLGKQ IKLKEVEGTL LQPATVDNWS QIQSFEAKPD DLLICTYPKA GTTWIQEIVD 

        70         80         90        100        110        120 
MIEQNGDVEK CQRAIIQHRH PFIEWARPPQ PSGVEKAKAM PSPRILKTHL STQLLPPSFW 

       130        140        150        160        170        180 
ENNCKFLYVA RNAKDCMVSY YHFQRMNHML PDPGTWEEYF ETFINGKVVW GSWFDHVKGW 

       190        200        210        220        230        240 
WEMKDRHQIL FLFYEDIKRD PKHEIRKVMQ FMGKKVDETV LDKIVQETSF EKMKENPMTN 

       250        260        270        280        290 
RSTVSKSILD QSISSFMRKG TVGDWKNHFT VAQNERFDEI YRRKMEGTSI NFCMEL 

« Hide

Isoform Long [UniParc].

Checksum: DB83191FA88BFAD1
Show »

FASTA30735,868

References

« Hide 'large scale' references
[1]"Human sulfotransferase SULT1C1: cDNA cloning, tissue-specific expression, and chromosomal localization."
Her C., Kaur G.P., Athwal R.S., Weinshilboum R.M.
Genomics 41:467-470(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Fetal liver and Fetal spleen.
[2]"Molecular characterization of ST1C1-related human sulfotransferase."
Yoshinari K., Nagata K., Shimada M., Yamazoe Y.
Carcinogenesis 19:951-953(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Fetal liver.
[3]"Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene."
Sakakibara Y., Yanagisawa K., Katafuchi J., Ringer D.P., Takami Y., Nakayama T., Suiko M., Liu M.-C.
J. Biol. Chem. 273:33929-33935(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
Tissue: Fetal lung.
[4]"Molecular cloning, expression, localisation and functional characterisation of a rabbit SULT1C2 sulfotransferase."
Hehonah N., Zhu X., Brix L., Bolton-Grob R., Barnett A., Windmill K., McManus M.
Int. J. Biochem. Cell Biol. 31:869-882(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
Tissue: Stomach.
[5]"Human sulfotransferases SULT1C1 and SULT1C2: cDNA characterization, gene cloning, and chromosomal localization."
Freimuth R.R., Raftogianis R.B., Wood T.C., Moon E., Kim U.-J., Xu J., Siciliano M.J., Weinshilboum R.M.
Genomics 65:157-165(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
[6]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
Tissue: Kidney.
[8]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Tissue: Kidney.
[11]"Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP)."
Dombrovski L., Dong A., Bochkarev A., Plotnikov A.N.
Proteins 64:1091-1094(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 3-296 IN COMPLEX WITH ADENOSINE-3'- 5'-DIPHOSPHATE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U66036 mRNA. Translation: AAC51285.1.
AB008164 mRNA. Translation: BAA28346.1.
AF026303 mRNA. Translation: AAC00409.1.
AF186251 mRNA. Translation: AAF72799.1.
AF186252 mRNA. Translation: AAF72800.1.
AF186253 mRNA. Translation: AAF72801.1.
AF186254 mRNA. Translation: AAF72802.1.
AF186255 mRNA. Translation: AAF72803.1.
AF186256 mRNA. Translation: AAF72804.1.
AF186262 expand/collapse EMBL AC list , AF186258, AF186260, AF186261 Genomic DNA. Translation: AAF72805.1.
AF186262 expand/collapse EMBL AC list , AF186258, AF186259, AF186260, AF186261 Genomic DNA. Translation: AAF72806.1.
BT006951 mRNA. Translation: AAP35597.1.
AK313193 mRNA. Translation: BAG36010.1.
AC019100 Genomic DNA. Translation: AAY14790.1.
CH471182 Genomic DNA. Translation: EAW53889.1.
CH471182 Genomic DNA. Translation: EAW53890.1.
BC005353 mRNA. Translation: AAH05353.1.
CCDSCCDS2075.1. [O00338-1]
CCDS2076.1. [O00338-2]
RefSeqNP_001047.1. NM_001056.3. [O00338-1]
NP_789795.1. NM_176825.2. [O00338-2]
UniGeneHs.436123.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3BFXX-ray1.80A/B3-296[»]
ProteinModelPortalO00338.
SMRO00338. Positions 12-296.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112688. 7 interactions.
IntActO00338. 2 interactions.
STRING9606.ENSP00000319622.

Chemistry

ChEMBLCHEMBL1743295.

Proteomic databases

MaxQBO00338.
PaxDbO00338.
PRIDEO00338.

Protocols and materials databases

DNASU6819.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000251481; ENSP00000251481; ENSG00000198203. [O00338-1]
ENST00000326853; ENSP00000319622; ENSG00000198203. [O00338-2]
GeneID6819.
KEGGhsa:6819.
UCSCuc002tdx.3. human. [O00338-2]
uc002tdy.3. human. [O00338-1]

Organism-specific databases

CTD6819.
GeneCardsGC02P108905.
HGNCHGNC:11456. SULT1C2.
HPAHPA007190.
MIM602385. gene.
neXtProtNX_O00338.
PharmGKBPA164742557.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG260792.
HOGENOMHOG000037209.
HOVERGENHBG001195.
KOK01025.
PhylomeDBO00338.
TreeFamTF321745.

Enzyme and pathway databases

BRENDA2.8.2.1. 2681.
ReactomeREACT_111217. Metabolism.

Gene expression databases

ArrayExpressO00338.
BgeeO00338.
CleanExHS_SULT1C2.
GenevestigatorO00338.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
ProtoNetSearch...

Other

EvolutionaryTraceO00338.
GeneWikiSULT1C2.
GenomeRNAi6819.
NextBio26627.
PROO00338.
SOURCESearch...

Entry information

Entry nameST1C2_HUMAN
AccessionPrimary (citable) accession number: O00338
Secondary accession number(s): B2R813, Q53SG4
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: July 9, 2014
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM