O00338 (ST1C2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sulfotransferase 1C2 Short name=ST1C2 EC=2.8.2.- Alternative name(s): Sulfotransferase 1C1 Short name=SULT1C#1 humSULTC2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 296 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF). |
| Subcellular location | |
| Tissue specificity | Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver. |
| Sequence similarities | Belongs to the sulfotransferase 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Transferase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | 3'-phosphoadenosine 5'-phosphosulfate metabolic process Traceable author statement. Source: Reactome amine metabolic processTraceable author statement Ref.1. Source: ProtInc sulfationInferred from direct assay PubMed 20056724. Source: BHF-UCL xenobiotic metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome microtubule cytoskeletonInferred from direct assay. Source: HPA |
| Molecular_function | sulfotransferase activity Inferred from direct assay PubMed 20056724. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Short (identifier: O00338-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Long (identifier: O00338-2) The sequence of this isoform differs from the canonical sequence as follows: 93-113: GVEKAKAMPSPRILKTHLSTQ → ETGFHHVAQAGLKLLSSSNPPASTSQSAKITD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 296 | 296 | Sulfotransferase 1C2 | PRO_0000085132 | ||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 49 – 54 | 6 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 228 – 233 | 6 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 256 – 260 | 5 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 107 – 109 | 3 | Substrate binding By similarity | |||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 109 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 131 | 1 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 139 | 1 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 194 | 1 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 93 – 113 | 21 | GVEKA…HLSTQ → ETGFHHVAQAGLKLLSSSNP PASTSQSAKITD in isoform Long. | VSP_006303 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 128 | 1 | Y → H. Corresponds to variant rs17036091 [ dbSNP | Ensembl ]. | VAR_021986 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 255 | 1 | S → A. Corresponds to variant rs17036104 [ dbSNP | Ensembl ]. | VAR_021987 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 282 | 1 | R → T. Corresponds to variant rs45515691 [ dbSNP | Ensembl ]. | VAR_061888 | ||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 14 – 16 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 19 – 21 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 23 – 27 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 29 – 33 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 42 – 46 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 52 – 64 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 99 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 105 – 108 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 112 – 114 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 121 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 125 – 130 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 133 – 146 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 156 – 164 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 183 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 184 – 186 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 187 – 193 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 194 – 199 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 211 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 218 – 227 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 230 – 235 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 265 – 268 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 271 – 285 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human sulfotransferase SULT1C1: cDNA cloning, tissue-specific expression, and chromosomal localization." Her C., Kaur G.P., Athwal R.S., Weinshilboum R.M. Genomics 41:467-470(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Fetal liver and Fetal spleen. |
| [2] | "Molecular characterization of ST1C1-related human sulfotransferase." Yoshinari K., Nagata K., Shimada M., Yamazoe Y. Carcinogenesis 19:951-953(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Fetal liver. |
| [3] | "Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene." Sakakibara Y., Yanagisawa K., Katafuchi J., Ringer D.P., Takami Y., Nakayama T., Suiko M., Liu M.-C. J. Biol. Chem. 273:33929-33935(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION. Tissue: Fetal lung. |
| [4] | "Molecular cloning, expression, localisation and functional characterisation of a rabbit SULT1C2 sulfotransferase." Hehonah N., Zhu X., Brix L., Bolton-Grob R., Barnett A., Windmill K., McManus M. Int. J. Biochem. Cell Biol. 31:869-882(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION. Tissue: Stomach. |
| [5] | "Human sulfotransferases SULT1C1 and SULT1C2: cDNA characterization, gene cloning, and chromosomal localization." Freimuth R.R., Raftogianis R.B., Wood T.C., Moon E., Kim U.-J., Xu J., Siciliano M.J., Weinshilboum R.M. Genomics 65:157-165(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [6] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Tissue: Kidney. |
| [8] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Kidney. |
| [11] | "Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP)." Dombrovski L., Dong A., Bochkarev A., Plotnikov A.N. Proteins 64:1091-1094(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 3-296 IN COMPLEX WITH ADENOSINE-3'- 5'-DIPHOSPHATE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U66036 mRNA. Translation: AAC51285.1. AB008164 mRNA. Translation: BAA28346.1. AF026303 mRNA. Translation: AAC00409.1. AF186251 mRNA. Translation: AAF72799.1. AF186252 mRNA. Translation: AAF72800.1. AF186253 mRNA. Translation: AAF72801.1. AF186254 mRNA. Translation: AAF72802.1. AF186255 mRNA. Translation: AAF72803.1. AF186256 mRNA. Translation: AAF72804.1. AF186262 AF186261 Genomic DNA. Translation: AAF72805.1.AF186262 AF186261 Genomic DNA. Translation: AAF72806.1.BT006951 mRNA. Translation: AAP35597.1. AK313193 mRNA. Translation: BAG36010.1. AC019100 Genomic DNA. Translation: AAY14790.1. CH471182 Genomic DNA. Translation: EAW53889.1. CH471182 Genomic DNA. Translation: EAW53890.1. BC005353 mRNA. Translation: AAH05353.1. | ||||||||||||
| IPI | IPI00011290. IPI00220643. | ||||||||||||
| RefSeq | NP_001047.1. NM_001056.3. NP_789795.1. NM_176825.2. | ||||||||||||
| UniGene | Hs.436123. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O00338. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O00338. 2 interactions. | ||||||||||||
| STRING | 9606.ENSP00000319622. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O00338. | ||||||||||||
| PRIDE | O00338. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 6819. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000251481; ENSP00000251481; ENSG00000198203. ENST00000326853; ENSP00000319622; ENSG00000198203. | ||||||||||||
| GeneID | 6819. | ||||||||||||
| KEGG | hsa:6819. | ||||||||||||
| UCSC | uc002tdx.3. human. uc002tdy.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6819. | ||||||||||||
| GeneCards | GC02P108905. | ||||||||||||
| HGNC | HGNC:11456. SULT1C2. | ||||||||||||
| HPA | HPA007190. | ||||||||||||
| MIM | 602385. gene. | ||||||||||||
| neXtProt | NX_O00338. | ||||||||||||
| PharmGKB | PA164742557. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG260792. | ||||||||||||
| HOGENOM | HOG000037209. | ||||||||||||
| HOVERGEN | HBG001195. | ||||||||||||
| KO | K01025. | ||||||||||||
| OrthoDB | EOG40S0G2. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.8.2.1. 2681. | ||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O00338. | ||||||||||||
| Bgee | O00338. | ||||||||||||
| CleanEx | HS_SULT1C2. | ||||||||||||
| Genevestigator | O00338. | ||||||||||||
| GermOnline | ENSG00000198203. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000863. Sulfotransferase_dom. [Graphical view] | ||||||||||||
| Pfam | PF00685. Sulfotransfer_1. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChEMBL | CHEMBL1743295. | ||||||||||||
| EvolutionaryTrace | O00338. | ||||||||||||
| GenomeRNAi | 6819. | ||||||||||||
| NextBio | 26627. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ST1C2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00338 Secondary accession number(s): B2R813, Q53SG4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
