SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O00338

- ST1C2_HUMAN

UniProt

O00338 - ST1C2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Sulfotransferase 1C2
Gene
SULT1C2, SULT1C1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei109 – 1091Proton acceptor By similarity
Binding sitei131 – 1311PAPS
Binding sitei139 – 1391PAPS
Binding sitei194 – 1941PAPS

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi49 – 546PAPS
Nucleotide bindingi228 – 2336PAPS
Nucleotide bindingi256 – 2605PAPS

GO - Molecular functioni

  1. sulfotransferase activity Source: BHF-UCL

GO - Biological processi

  1. 3'-phosphoadenosine 5'-phosphosulfate metabolic process Source: Reactome
  2. amine metabolic process Source: ProtInc
  3. small molecule metabolic process Source: Reactome
  4. sulfation Source: BHF-UCL
  5. xenobiotic metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

BRENDAi2.8.2.1. 2681.
ReactomeiREACT_6913. Cytosolic sulfonation of small molecules.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 1C2 (EC:2.8.2.-)
Short name:
ST1C2
Alternative name(s):
Sulfotransferase 1C1
Short name:
SULT1C#1
humSULTC2
Gene namesi
Name:SULT1C2
Synonyms:SULT1C1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:11456. SULT1C2.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: ProtInc
  2. cytosol Source: Reactome
  3. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164742557.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 296296Sulfotransferase 1C2
PRO_0000085132Add
BLAST

Proteomic databases

MaxQBiO00338.
PaxDbiO00338.
PRIDEiO00338.

Expressioni

Tissue specificityi

Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.

Gene expression databases

ArrayExpressiO00338.
BgeeiO00338.
CleanExiHS_SULT1C2.
GenevestigatoriO00338.

Organism-specific databases

HPAiHPA007190.

Interactioni

Protein-protein interaction databases

BioGridi112688. 7 interactions.
IntActiO00338. 2 interactions.
STRINGi9606.ENSP00000319622.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi14 – 163
Beta strandi19 – 213
Helixi23 – 275
Helixi29 – 335
Beta strandi42 – 465
Helixi52 – 6413
Helixi93 – 997
Beta strandi105 – 1084
Turni112 – 1143
Helixi118 – 1214
Beta strandi125 – 1306
Helixi133 – 14614
Helixi156 – 1649
Helixi173 – 18311
Turni184 – 1863
Beta strandi187 – 1937
Helixi194 – 1996
Helixi201 – 21111
Helixi218 – 22710
Helixi230 – 2356
Helixi265 – 2684
Helixi271 – 28515

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3BFXX-ray1.80A/B3-296[»]
ProteinModelPortaliO00338.
SMRiO00338. Positions 12-296.

Miscellaneous databases

EvolutionaryTraceiO00338.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni107 – 1093Substrate binding By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG260792.
HOGENOMiHOG000037209.
HOVERGENiHBG001195.
KOiK01025.
PhylomeDBiO00338.
TreeFamiTF321745.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Short (identifier: O00338-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALTSDLGKQ IKLKEVEGTL LQPATVDNWS QIQSFEAKPD DLLICTYPKA    50
GTTWIQEIVD MIEQNGDVEK CQRAIIQHRH PFIEWARPPQ PSGVEKAKAM 100
PSPRILKTHL STQLLPPSFW ENNCKFLYVA RNAKDCMVSY YHFQRMNHML 150
PDPGTWEEYF ETFINGKVVW GSWFDHVKGW WEMKDRHQIL FLFYEDIKRD 200
PKHEIRKVMQ FMGKKVDETV LDKIVQETSF EKMKENPMTN RSTVSKSILD 250
QSISSFMRKG TVGDWKNHFT VAQNERFDEI YRRKMEGTSI NFCMEL 296
Length:296
Mass (Da):34,880
Last modified:July 1, 1997 - v1
Checksum:i3DC01C8A8ED61EFD
GO
Isoform Long (identifier: O00338-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-113: GVEKAKAMPSPRILKTHLSTQ → ETGFHHVAQAGLKLLSSSNPPASTSQSAKITD

Show »
Length:307
Mass (Da):35,868
Checksum:iDB83191FA88BFAD1
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti128 – 1281Y → H.
Corresponds to variant rs17036091 [ dbSNP | Ensembl ].
VAR_021986
Natural varianti255 – 2551S → A.
Corresponds to variant rs17036104 [ dbSNP | Ensembl ].
VAR_021987
Natural varianti282 – 2821R → T.
Corresponds to variant rs45515691 [ dbSNP | Ensembl ].
VAR_061888

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei93 – 11321GVEKA…HLSTQ → ETGFHHVAQAGLKLLSSSNP PASTSQSAKITD in isoform Long.
VSP_006303Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66036 mRNA. Translation: AAC51285.1.
AB008164 mRNA. Translation: BAA28346.1.
AF026303 mRNA. Translation: AAC00409.1.
AF186251 mRNA. Translation: AAF72799.1.
AF186252 mRNA. Translation: AAF72800.1.
AF186253 mRNA. Translation: AAF72801.1.
AF186254 mRNA. Translation: AAF72802.1.
AF186255 mRNA. Translation: AAF72803.1.
AF186256 mRNA. Translation: AAF72804.1.
AF186262
, AF186258, AF186260, AF186261 Genomic DNA. Translation: AAF72805.1.
AF186262
, AF186258, AF186259, AF186260, AF186261 Genomic DNA. Translation: AAF72806.1.
BT006951 mRNA. Translation: AAP35597.1.
AK313193 mRNA. Translation: BAG36010.1.
AC019100 Genomic DNA. Translation: AAY14790.1.
CH471182 Genomic DNA. Translation: EAW53889.1.
CH471182 Genomic DNA. Translation: EAW53890.1.
BC005353 mRNA. Translation: AAH05353.1.
CCDSiCCDS2075.1. [O00338-1]
CCDS2076.1. [O00338-2]
RefSeqiNP_001047.1. NM_001056.3. [O00338-1]
NP_789795.1. NM_176825.2. [O00338-2]
UniGeneiHs.436123.

Genome annotation databases

EnsembliENST00000251481; ENSP00000251481; ENSG00000198203. [O00338-1]
ENST00000326853; ENSP00000319622; ENSG00000198203. [O00338-2]
GeneIDi6819.
KEGGihsa:6819.
UCSCiuc002tdx.3. human. [O00338-2]
uc002tdy.3. human. [O00338-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66036 mRNA. Translation: AAC51285.1 .
AB008164 mRNA. Translation: BAA28346.1 .
AF026303 mRNA. Translation: AAC00409.1 .
AF186251 mRNA. Translation: AAF72799.1 .
AF186252 mRNA. Translation: AAF72800.1 .
AF186253 mRNA. Translation: AAF72801.1 .
AF186254 mRNA. Translation: AAF72802.1 .
AF186255 mRNA. Translation: AAF72803.1 .
AF186256 mRNA. Translation: AAF72804.1 .
AF186262
, AF186258 , AF186260 , AF186261 Genomic DNA. Translation: AAF72805.1 .
AF186262
, AF186258 , AF186259 , AF186260 , AF186261 Genomic DNA. Translation: AAF72806.1 .
BT006951 mRNA. Translation: AAP35597.1 .
AK313193 mRNA. Translation: BAG36010.1 .
AC019100 Genomic DNA. Translation: AAY14790.1 .
CH471182 Genomic DNA. Translation: EAW53889.1 .
CH471182 Genomic DNA. Translation: EAW53890.1 .
BC005353 mRNA. Translation: AAH05353.1 .
CCDSi CCDS2075.1. [O00338-1 ]
CCDS2076.1. [O00338-2 ]
RefSeqi NP_001047.1. NM_001056.3. [O00338-1 ]
NP_789795.1. NM_176825.2. [O00338-2 ]
UniGenei Hs.436123.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3BFX X-ray 1.80 A/B 3-296 [» ]
ProteinModelPortali O00338.
SMRi O00338. Positions 12-296.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112688. 7 interactions.
IntActi O00338. 2 interactions.
STRINGi 9606.ENSP00000319622.

Chemistry

ChEMBLi CHEMBL1743295.

Proteomic databases

MaxQBi O00338.
PaxDbi O00338.
PRIDEi O00338.

Protocols and materials databases

DNASUi 6819.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000251481 ; ENSP00000251481 ; ENSG00000198203 . [O00338-1 ]
ENST00000326853 ; ENSP00000319622 ; ENSG00000198203 . [O00338-2 ]
GeneIDi 6819.
KEGGi hsa:6819.
UCSCi uc002tdx.3. human. [O00338-2 ]
uc002tdy.3. human. [O00338-1 ]

Organism-specific databases

CTDi 6819.
GeneCardsi GC02P108905.
HGNCi HGNC:11456. SULT1C2.
HPAi HPA007190.
MIMi 602385. gene.
neXtProti NX_O00338.
PharmGKBi PA164742557.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG260792.
HOGENOMi HOG000037209.
HOVERGENi HBG001195.
KOi K01025.
PhylomeDBi O00338.
TreeFami TF321745.

Enzyme and pathway databases

BRENDAi 2.8.2.1. 2681.
Reactomei REACT_6913. Cytosolic sulfonation of small molecules.

Miscellaneous databases

EvolutionaryTracei O00338.
GeneWikii SULT1C2.
GenomeRNAii 6819.
NextBioi 26627.
PROi O00338.
SOURCEi Search...

Gene expression databases

ArrayExpressi O00338.
Bgeei O00338.
CleanExi HS_SULT1C2.
Genevestigatori O00338.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view ]
Pfami PF00685. Sulfotransfer_1. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human sulfotransferase SULT1C1: cDNA cloning, tissue-specific expression, and chromosomal localization."
    Her C., Kaur G.P., Athwal R.S., Weinshilboum R.M.
    Genomics 41:467-470(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Fetal liver and Fetal spleen.
  2. "Molecular characterization of ST1C1-related human sulfotransferase."
    Yoshinari K., Nagata K., Shimada M., Yamazoe Y.
    Carcinogenesis 19:951-953(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Fetal liver.
  3. "Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene."
    Sakakibara Y., Yanagisawa K., Katafuchi J., Ringer D.P., Takami Y., Nakayama T., Suiko M., Liu M.-C.
    J. Biol. Chem. 273:33929-33935(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
    Tissue: Fetal lung.
  4. "Molecular cloning, expression, localisation and functional characterisation of a rabbit SULT1C2 sulfotransferase."
    Hehonah N., Zhu X., Brix L., Bolton-Grob R., Barnett A., Windmill K., McManus M.
    Int. J. Biochem. Cell Biol. 31:869-882(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
    Tissue: Stomach.
  5. "Human sulfotransferases SULT1C1 and SULT1C2: cDNA characterization, gene cloning, and chromosomal localization."
    Freimuth R.R., Raftogianis R.B., Wood T.C., Moon E., Kim U.-J., Xu J., Siciliano M.J., Weinshilboum R.M.
    Genomics 65:157-165(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
  6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
    Tissue: Kidney.
  8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Kidney.
  11. "Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP)."
    Dombrovski L., Dong A., Bochkarev A., Plotnikov A.N.
    Proteins 64:1091-1094(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 3-296 IN COMPLEX WITH ADENOSINE-3'- 5'-DIPHOSPHATE.

Entry informationi

Entry nameiST1C2_HUMAN
AccessioniPrimary (citable) accession number: O00338
Secondary accession number(s): B2R813, Q53SG4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: September 3, 2014
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi