Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 1C2

Gene

SULT1C2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hydroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei109Proton acceptorBy similarity1
Binding sitei131PAPS1
Binding sitei139PAPS1
Binding sitei194PAPS1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi49 – 54PAPS6
Nucleotide bindingi228 – 233PAPS6
Nucleotide bindingi256 – 260PAPS5

GO - Molecular functioni

  • aryl sulfotransferase activity Source: Reactome
  • sulfotransferase activity Source: BHF-UCL

GO - Biological processi

  • 3'-phosphoadenosine 5'-phosphosulfate metabolic process Source: Reactome
  • amine metabolic process Source: ProtInc
  • sulfation Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 1C2 (EC:2.8.2.-)
Short name:
ST1C2
Alternative name(s):
Sulfotransferase 1C1
Short name:
SULT1C#1
humSULTC2
Gene namesi
Name:SULT1C2
Synonyms:SULT1C1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:11456. SULT1C2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: ProtInc
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi6819.
OpenTargetsiENSG00000198203.
PharmGKBiPA164742557.

Chemistry databases

ChEMBLiCHEMBL1743295.

Polymorphism and mutation databases

BioMutaiSULT1C2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000851321 – 296Sulfotransferase 1C2Add BLAST296

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei139PhosphoserineBy similarity1
Modified residuei254PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO00338.
PeptideAtlasiO00338.
PRIDEiO00338.

PTM databases

iPTMnetiO00338.
PhosphoSitePlusiO00338.

Expressioni

Tissue specificityi

Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.

Gene expression databases

BgeeiENSG00000198203.
CleanExiHS_SULT1C2.
ExpressionAtlasiO00338. baseline and differential.
GenevisibleiO00338. HS.

Organism-specific databases

HPAiHPA007190.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-3913419,EBI-717399

Protein-protein interaction databases

BioGridi112688. 10 interactors.
IntActiO00338. 6 interactors.

Structurei

Secondary structure

1296
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi14 – 16Combined sources3
Beta strandi19 – 21Combined sources3
Helixi23 – 27Combined sources5
Helixi29 – 33Combined sources5
Beta strandi42 – 46Combined sources5
Helixi52 – 64Combined sources13
Helixi93 – 99Combined sources7
Beta strandi105 – 108Combined sources4
Turni112 – 114Combined sources3
Helixi118 – 121Combined sources4
Beta strandi125 – 130Combined sources6
Helixi133 – 146Combined sources14
Helixi156 – 164Combined sources9
Helixi173 – 183Combined sources11
Turni184 – 186Combined sources3
Beta strandi187 – 193Combined sources7
Helixi194 – 199Combined sources6
Helixi201 – 211Combined sources11
Helixi218 – 227Combined sources10
Helixi230 – 235Combined sources6
Helixi265 – 268Combined sources4
Helixi271 – 285Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3BFXX-ray1.80A/B3-296[»]
ProteinModelPortaliO00338.
SMRiO00338.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00338.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni107 – 109Substrate bindingBy similarity3

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

GeneTreeiENSGT00760000118932.
HOGENOMiHOG000037209.
HOVERGENiHBG001195.
InParanoidiO00338.
KOiK01025.
PhylomeDBiO00338.
TreeFamiTF321745.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Short (identifier: O00338-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALTSDLGKQ IKLKEVEGTL LQPATVDNWS QIQSFEAKPD DLLICTYPKA
60 70 80 90 100
GTTWIQEIVD MIEQNGDVEK CQRAIIQHRH PFIEWARPPQ PSGVEKAKAM
110 120 130 140 150
PSPRILKTHL STQLLPPSFW ENNCKFLYVA RNAKDCMVSY YHFQRMNHML
160 170 180 190 200
PDPGTWEEYF ETFINGKVVW GSWFDHVKGW WEMKDRHQIL FLFYEDIKRD
210 220 230 240 250
PKHEIRKVMQ FMGKKVDETV LDKIVQETSF EKMKENPMTN RSTVSKSILD
260 270 280 290
QSISSFMRKG TVGDWKNHFT VAQNERFDEI YRRKMEGTSI NFCMEL
Length:296
Mass (Da):34,880
Last modified:July 1, 1997 - v1
Checksum:i3DC01C8A8ED61EFD
GO
Isoform Long (identifier: O00338-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-113: GVEKAKAMPSPRILKTHLSTQ → ETGFHHVAQAGLKLLSSSNPPASTSQSAKITD

Show »
Length:307
Mass (Da):35,868
Checksum:iDB83191FA88BFAD1
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_021986128Y → H.Corresponds to variant rs17036091dbSNPEnsembl.1
Natural variantiVAR_021987255S → A.Corresponds to variant rs17036104dbSNPEnsembl.1
Natural variantiVAR_061888282R → T.Corresponds to variant rs45515691dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00630393 – 113GVEKA…HLSTQ → ETGFHHVAQAGLKLLSSSNP PASTSQSAKITD in isoform Long. CuratedAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66036 mRNA. Translation: AAC51285.1.
AB008164 mRNA. Translation: BAA28346.1.
AF026303 mRNA. Translation: AAC00409.1.
AF186251 mRNA. Translation: AAF72799.1.
AF186252 mRNA. Translation: AAF72800.1.
AF186253 mRNA. Translation: AAF72801.1.
AF186254 mRNA. Translation: AAF72802.1.
AF186255 mRNA. Translation: AAF72803.1.
AF186256 mRNA. Translation: AAF72804.1.
AF186262
, AF186258, AF186260, AF186261 Genomic DNA. Translation: AAF72805.1.
AF186262
, AF186258, AF186259, AF186260, AF186261 Genomic DNA. Translation: AAF72806.1.
BT006951 mRNA. Translation: AAP35597.1.
AK313193 mRNA. Translation: BAG36010.1.
AC019100 Genomic DNA. Translation: AAY14790.1.
CH471182 Genomic DNA. Translation: EAW53889.1.
CH471182 Genomic DNA. Translation: EAW53890.1.
BC005353 mRNA. Translation: AAH05353.1.
CCDSiCCDS2075.1. [O00338-1]
CCDS2076.1. [O00338-2]
RefSeqiNP_001047.1. NM_001056.3. [O00338-1]
NP_789795.1. NM_176825.2. [O00338-2]
UniGeneiHs.436123.

Genome annotation databases

EnsembliENST00000251481; ENSP00000251481; ENSG00000198203. [O00338-1]
ENST00000326853; ENSP00000319622; ENSG00000198203. [O00338-2]
GeneIDi6819.
KEGGihsa:6819.
UCSCiuc002tdx.3. human. [O00338-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66036 mRNA. Translation: AAC51285.1.
AB008164 mRNA. Translation: BAA28346.1.
AF026303 mRNA. Translation: AAC00409.1.
AF186251 mRNA. Translation: AAF72799.1.
AF186252 mRNA. Translation: AAF72800.1.
AF186253 mRNA. Translation: AAF72801.1.
AF186254 mRNA. Translation: AAF72802.1.
AF186255 mRNA. Translation: AAF72803.1.
AF186256 mRNA. Translation: AAF72804.1.
AF186262
, AF186258, AF186260, AF186261 Genomic DNA. Translation: AAF72805.1.
AF186262
, AF186258, AF186259, AF186260, AF186261 Genomic DNA. Translation: AAF72806.1.
BT006951 mRNA. Translation: AAP35597.1.
AK313193 mRNA. Translation: BAG36010.1.
AC019100 Genomic DNA. Translation: AAY14790.1.
CH471182 Genomic DNA. Translation: EAW53889.1.
CH471182 Genomic DNA. Translation: EAW53890.1.
BC005353 mRNA. Translation: AAH05353.1.
CCDSiCCDS2075.1. [O00338-1]
CCDS2076.1. [O00338-2]
RefSeqiNP_001047.1. NM_001056.3. [O00338-1]
NP_789795.1. NM_176825.2. [O00338-2]
UniGeneiHs.436123.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3BFXX-ray1.80A/B3-296[»]
ProteinModelPortaliO00338.
SMRiO00338.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112688. 10 interactors.
IntActiO00338. 6 interactors.

Chemistry databases

ChEMBLiCHEMBL1743295.

PTM databases

iPTMnetiO00338.
PhosphoSitePlusiO00338.

Polymorphism and mutation databases

BioMutaiSULT1C2.

Proteomic databases

MaxQBiO00338.
PeptideAtlasiO00338.
PRIDEiO00338.

Protocols and materials databases

DNASUi6819.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251481; ENSP00000251481; ENSG00000198203. [O00338-1]
ENST00000326853; ENSP00000319622; ENSG00000198203. [O00338-2]
GeneIDi6819.
KEGGihsa:6819.
UCSCiuc002tdx.3. human. [O00338-1]

Organism-specific databases

CTDi6819.
DisGeNETi6819.
GeneCardsiSULT1C2.
HGNCiHGNC:11456. SULT1C2.
HPAiHPA007190.
MIMi602385. gene.
neXtProtiNX_O00338.
OpenTargetsiENSG00000198203.
PharmGKBiPA164742557.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118932.
HOGENOMiHOG000037209.
HOVERGENiHBG001195.
InParanoidiO00338.
KOiK01025.
PhylomeDBiO00338.
TreeFamiTF321745.

Enzyme and pathway databases

ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.

Miscellaneous databases

EvolutionaryTraceiO00338.
GeneWikiiSULT1C2.
GenomeRNAii6819.
PROiO00338.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198203.
CleanExiHS_SULT1C2.
ExpressionAtlasiO00338. baseline and differential.
GenevisibleiO00338. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiST1C2_HUMAN
AccessioniPrimary (citable) accession number: O00338
Secondary accession number(s): B2R813, Q53SG4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: November 2, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.