Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O00338

- ST1C2_HUMAN

UniProt

O00338 - ST1C2_HUMAN

Protein

Sulfotransferase 1C2

Gene

SULT1C2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 1 (01 Jul 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei109 – 1091Proton acceptorBy similarity
    Binding sitei131 – 1311PAPS
    Binding sitei139 – 1391PAPS
    Binding sitei194 – 1941PAPS

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi49 – 546PAPS
    Nucleotide bindingi228 – 2336PAPS
    Nucleotide bindingi256 – 2605PAPS

    GO - Molecular functioni

    1. sulfotransferase activity Source: BHF-UCL

    GO - Biological processi

    1. 3'-phosphoadenosine 5'-phosphosulfate metabolic process Source: Reactome
    2. amine metabolic process Source: ProtInc
    3. small molecule metabolic process Source: Reactome
    4. sulfation Source: BHF-UCL
    5. xenobiotic metabolic process Source: Reactome

    Keywords - Molecular functioni

    Transferase

    Enzyme and pathway databases

    BRENDAi2.8.2.1. 2681.
    ReactomeiREACT_6913. Cytosolic sulfonation of small molecules.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sulfotransferase 1C2 (EC:2.8.2.-)
    Short name:
    ST1C2
    Alternative name(s):
    Sulfotransferase 1C1
    Short name:
    SULT1C#1
    humSULTC2
    Gene namesi
    Name:SULT1C2
    Synonyms:SULT1C1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:11456. SULT1C2.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: ProtInc
    2. cytosol Source: Reactome
    3. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164742557.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 296296Sulfotransferase 1C2PRO_0000085132Add
    BLAST

    Proteomic databases

    MaxQBiO00338.
    PaxDbiO00338.
    PRIDEiO00338.

    Expressioni

    Tissue specificityi

    Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.

    Gene expression databases

    ArrayExpressiO00338.
    BgeeiO00338.
    CleanExiHS_SULT1C2.
    GenevestigatoriO00338.

    Organism-specific databases

    HPAiHPA007190.

    Interactioni

    Protein-protein interaction databases

    BioGridi112688. 7 interactions.
    IntActiO00338. 2 interactions.
    STRINGi9606.ENSP00000319622.

    Structurei

    Secondary structure

    1
    296
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi14 – 163
    Beta strandi19 – 213
    Helixi23 – 275
    Helixi29 – 335
    Beta strandi42 – 465
    Helixi52 – 6413
    Helixi93 – 997
    Beta strandi105 – 1084
    Turni112 – 1143
    Helixi118 – 1214
    Beta strandi125 – 1306
    Helixi133 – 14614
    Helixi156 – 1649
    Helixi173 – 18311
    Turni184 – 1863
    Beta strandi187 – 1937
    Helixi194 – 1996
    Helixi201 – 21111
    Helixi218 – 22710
    Helixi230 – 2356
    Helixi265 – 2684
    Helixi271 – 28515

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3BFXX-ray1.80A/B3-296[»]
    ProteinModelPortaliO00338.
    SMRiO00338. Positions 12-296.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO00338.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni107 – 1093Substrate bindingBy similarity

    Sequence similaritiesi

    Belongs to the sulfotransferase 1 family.Curated

    Phylogenomic databases

    eggNOGiNOG260792.
    HOGENOMiHOG000037209.
    HOVERGENiHBG001195.
    KOiK01025.
    PhylomeDBiO00338.
    TreeFamiTF321745.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR000863. Sulfotransferase_dom.
    [Graphical view]
    PfamiPF00685. Sulfotransfer_1. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Short (identifier: O00338-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALTSDLGKQ IKLKEVEGTL LQPATVDNWS QIQSFEAKPD DLLICTYPKA    50
    GTTWIQEIVD MIEQNGDVEK CQRAIIQHRH PFIEWARPPQ PSGVEKAKAM 100
    PSPRILKTHL STQLLPPSFW ENNCKFLYVA RNAKDCMVSY YHFQRMNHML 150
    PDPGTWEEYF ETFINGKVVW GSWFDHVKGW WEMKDRHQIL FLFYEDIKRD 200
    PKHEIRKVMQ FMGKKVDETV LDKIVQETSF EKMKENPMTN RSTVSKSILD 250
    QSISSFMRKG TVGDWKNHFT VAQNERFDEI YRRKMEGTSI NFCMEL 296
    Length:296
    Mass (Da):34,880
    Last modified:July 1, 1997 - v1
    Checksum:i3DC01C8A8ED61EFD
    GO
    Isoform Long (identifier: O00338-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         93-113: GVEKAKAMPSPRILKTHLSTQ → ETGFHHVAQAGLKLLSSSNPPASTSQSAKITD

    Show »
    Length:307
    Mass (Da):35,868
    Checksum:iDB83191FA88BFAD1
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti128 – 1281Y → H.
    Corresponds to variant rs17036091 [ dbSNP | Ensembl ].
    VAR_021986
    Natural varianti255 – 2551S → A.
    Corresponds to variant rs17036104 [ dbSNP | Ensembl ].
    VAR_021987
    Natural varianti282 – 2821R → T.
    Corresponds to variant rs45515691 [ dbSNP | Ensembl ].
    VAR_061888

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei93 – 11321GVEKA…HLSTQ → ETGFHHVAQAGLKLLSSSNP PASTSQSAKITD in isoform Long. CuratedVSP_006303Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66036 mRNA. Translation: AAC51285.1.
    AB008164 mRNA. Translation: BAA28346.1.
    AF026303 mRNA. Translation: AAC00409.1.
    AF186251 mRNA. Translation: AAF72799.1.
    AF186252 mRNA. Translation: AAF72800.1.
    AF186253 mRNA. Translation: AAF72801.1.
    AF186254 mRNA. Translation: AAF72802.1.
    AF186255 mRNA. Translation: AAF72803.1.
    AF186256 mRNA. Translation: AAF72804.1.
    AF186262
    , AF186258, AF186260, AF186261 Genomic DNA. Translation: AAF72805.1.
    AF186262
    , AF186258, AF186259, AF186260, AF186261 Genomic DNA. Translation: AAF72806.1.
    BT006951 mRNA. Translation: AAP35597.1.
    AK313193 mRNA. Translation: BAG36010.1.
    AC019100 Genomic DNA. Translation: AAY14790.1.
    CH471182 Genomic DNA. Translation: EAW53889.1.
    CH471182 Genomic DNA. Translation: EAW53890.1.
    BC005353 mRNA. Translation: AAH05353.1.
    CCDSiCCDS2075.1. [O00338-1]
    CCDS2076.1. [O00338-2]
    RefSeqiNP_001047.1. NM_001056.3. [O00338-1]
    NP_789795.1. NM_176825.2. [O00338-2]
    UniGeneiHs.436123.

    Genome annotation databases

    EnsembliENST00000251481; ENSP00000251481; ENSG00000198203. [O00338-1]
    ENST00000326853; ENSP00000319622; ENSG00000198203. [O00338-2]
    GeneIDi6819.
    KEGGihsa:6819.
    UCSCiuc002tdx.3. human. [O00338-2]
    uc002tdy.3. human. [O00338-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66036 mRNA. Translation: AAC51285.1 .
    AB008164 mRNA. Translation: BAA28346.1 .
    AF026303 mRNA. Translation: AAC00409.1 .
    AF186251 mRNA. Translation: AAF72799.1 .
    AF186252 mRNA. Translation: AAF72800.1 .
    AF186253 mRNA. Translation: AAF72801.1 .
    AF186254 mRNA. Translation: AAF72802.1 .
    AF186255 mRNA. Translation: AAF72803.1 .
    AF186256 mRNA. Translation: AAF72804.1 .
    AF186262
    , AF186258 , AF186260 , AF186261 Genomic DNA. Translation: AAF72805.1 .
    AF186262
    , AF186258 , AF186259 , AF186260 , AF186261 Genomic DNA. Translation: AAF72806.1 .
    BT006951 mRNA. Translation: AAP35597.1 .
    AK313193 mRNA. Translation: BAG36010.1 .
    AC019100 Genomic DNA. Translation: AAY14790.1 .
    CH471182 Genomic DNA. Translation: EAW53889.1 .
    CH471182 Genomic DNA. Translation: EAW53890.1 .
    BC005353 mRNA. Translation: AAH05353.1 .
    CCDSi CCDS2075.1. [O00338-1 ]
    CCDS2076.1. [O00338-2 ]
    RefSeqi NP_001047.1. NM_001056.3. [O00338-1 ]
    NP_789795.1. NM_176825.2. [O00338-2 ]
    UniGenei Hs.436123.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3BFX X-ray 1.80 A/B 3-296 [» ]
    ProteinModelPortali O00338.
    SMRi O00338. Positions 12-296.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112688. 7 interactions.
    IntActi O00338. 2 interactions.
    STRINGi 9606.ENSP00000319622.

    Chemistry

    ChEMBLi CHEMBL1743295.

    Proteomic databases

    MaxQBi O00338.
    PaxDbi O00338.
    PRIDEi O00338.

    Protocols and materials databases

    DNASUi 6819.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000251481 ; ENSP00000251481 ; ENSG00000198203 . [O00338-1 ]
    ENST00000326853 ; ENSP00000319622 ; ENSG00000198203 . [O00338-2 ]
    GeneIDi 6819.
    KEGGi hsa:6819.
    UCSCi uc002tdx.3. human. [O00338-2 ]
    uc002tdy.3. human. [O00338-1 ]

    Organism-specific databases

    CTDi 6819.
    GeneCardsi GC02P108905.
    HGNCi HGNC:11456. SULT1C2.
    HPAi HPA007190.
    MIMi 602385. gene.
    neXtProti NX_O00338.
    PharmGKBi PA164742557.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG260792.
    HOGENOMi HOG000037209.
    HOVERGENi HBG001195.
    KOi K01025.
    PhylomeDBi O00338.
    TreeFami TF321745.

    Enzyme and pathway databases

    BRENDAi 2.8.2.1. 2681.
    Reactomei REACT_6913. Cytosolic sulfonation of small molecules.

    Miscellaneous databases

    EvolutionaryTracei O00338.
    GeneWikii SULT1C2.
    GenomeRNAii 6819.
    NextBioi 26627.
    PROi O00338.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O00338.
    Bgeei O00338.
    CleanExi HS_SULT1C2.
    Genevestigatori O00338.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR000863. Sulfotransferase_dom.
    [Graphical view ]
    Pfami PF00685. Sulfotransfer_1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Human sulfotransferase SULT1C1: cDNA cloning, tissue-specific expression, and chromosomal localization."
      Her C., Kaur G.P., Athwal R.S., Weinshilboum R.M.
      Genomics 41:467-470(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Fetal liver and Fetal spleen.
    2. "Molecular characterization of ST1C1-related human sulfotransferase."
      Yoshinari K., Nagata K., Shimada M., Yamazoe Y.
      Carcinogenesis 19:951-953(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Fetal liver.
    3. "Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene."
      Sakakibara Y., Yanagisawa K., Katafuchi J., Ringer D.P., Takami Y., Nakayama T., Suiko M., Liu M.-C.
      J. Biol. Chem. 273:33929-33935(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
      Tissue: Fetal lung.
    4. "Molecular cloning, expression, localisation and functional characterisation of a rabbit SULT1C2 sulfotransferase."
      Hehonah N., Zhu X., Brix L., Bolton-Grob R., Barnett A., Windmill K., McManus M.
      Int. J. Biochem. Cell Biol. 31:869-882(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
      Tissue: Stomach.
    5. "Human sulfotransferases SULT1C1 and SULT1C2: cDNA characterization, gene cloning, and chromosomal localization."
      Freimuth R.R., Raftogianis R.B., Wood T.C., Moon E., Kim U.-J., Xu J., Siciliano M.J., Weinshilboum R.M.
      Genomics 65:157-165(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
      Tissue: Kidney.
    8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Kidney.
    11. "Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP)."
      Dombrovski L., Dong A., Bochkarev A., Plotnikov A.N.
      Proteins 64:1091-1094(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 3-296 IN COMPLEX WITH ADENOSINE-3'- 5'-DIPHOSPHATE.

    Entry informationi

    Entry nameiST1C2_HUMAN
    AccessioniPrimary (citable) accession number: O00338
    Secondary accession number(s): B2R813, Q53SG4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: July 1, 1997
    Last modified: October 1, 2014
    This is version 138 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3