O00305 (CACB4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit beta-4 Short name=CAB4 Alternative name(s): Calcium channel voltage-dependent subunit beta 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 520 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. |
| Subunit structure | The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with FASLG. Ref.8 |
| Tissue specificity | Expressed predominantly in the cerebellum and kidney. |
| Involvement in disease | Defects in CACNB4 are the cause of susceptibility to idiopathic generalized epilepsy type 9 (IGE9) [MIM:607682]. IGE9 is a disorder characterized by recurring generalized seizures in the absence of detectable brain lesions and/or metabolic abnormalities. Generalized seizures arise diffusely and simultaneously from both hemispheres of the brain. Ref.7 Defects in CACNB4 are the cause of susceptibility to juvenile myoclonic epilepsy type 6 (EJM6) [MIM:607682]. EJM6 is a subtype of idiopathic generalized epilepsy. Patients have afebrile seizures only, with onset in adolescence (rather than in childhood) and myoclonic jerks which usually occur after awakening and are triggered by sleep deprivation and fatigue. Defects in CACNB4 are the cause of episodic ataxia type 5 (EA5) [MIM:613855]. EA5 is a disorder characterized by episodes of vertigo and ataxia that last for several hours. Interictal examination show spontaneous downbeat and gaze-evoked nystagmus, mild dysarthria and truncal ataxia. Ref.7 |
| Sequence similarities | Belongs to the calcium channel beta subunit family. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SYT1 | P21579 | 2 | EBI-714855,EBI-524909 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: O00305-1) Also known as: 4b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: O00305-2) Also known as: 4a; The sequence of this isoform differs from the canonical sequence as follows: 1-49: MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQ → MYDNLYLHGIEDSEA | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 12 | 1 | D → N in AAL14351. Ref.2 | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||
Molecule processing | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 520 | 520 | Voltage-dependent L-type calcium channel subunit beta-4 | PRO_0000144060 | ||||||||||||||
Regions | ||||||||||||||||||
| Domain | 118 – 153 | 36 | SH3 | |||||||||||||||
Amino acid modifications | ||||||||||||||||||
| Modified residue | 39 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 405 | 1 | Phosphothreonine By similarity | |||||||||||||||
| Modified residue | 406 | 1 | Phosphoserine By similarity | |||||||||||||||
| Modified residue | 411 | 1 | Phosphothreonine By similarity | |||||||||||||||
| Modified residue | 508 | 1 | Phosphoserine By similarity | |||||||||||||||
Natural variations | ||||||||||||||||||
| Alternative sequence | 1 – 49 | 49 | MSSSS…FILRQ → MYDNLYLHGIEDSEA in isoform 2. | VSP_000635 | ||||||||||||||
| Natural variant | 104 | 1 | C → F in EA5; associated with susceptibility to IGE9. Ref.7 Corresponds to variant rs1805031 [ dbSNP | Ensembl ]. | VAR_013669 | ||||||||||||||
Experimental info | ||||||||||||||||||
| Sequence conflict | 245 | 1 | F → S in AAB53333. Ref.1 | |||||||||||||||
| Sequence conflict | 245 | 1 | F → S in AAL14351. Ref.2 | |||||||||||||||
| Sequence conflict | 311 | 1 | L → V in AAL14351. Ref.2 | |||||||||||||||
| Sequence conflict | 441 | 1 | S → T in AAL14351. Ref.2 | |||||||||||||||
Secondary structure | ||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||
| Beta strand | 51 – 54 | 4 | ||||||||||||||||
| Beta strand | 57 – 59 | 3 | ||||||||||||||||
| Helix | 66 – 68 | 3 | ||||||||||||||||
| Turn | 71 – 73 | 3 | ||||||||||||||||
| Helix | 74 – 88 | 15 | ||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Assignment of human genes for beta 2 and beta 4 subunits of voltage-dependent Ca2+ channels to chromosomes 10p12 and 2q22-q23." Taviaux S., Williams M.E., Harpold M.M., Nargeot J., Lory P. Hum. Genet. 100:151-154(1997) [PubMed: 9254841] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Alternative splicing of the beta 4 subunit has alpha 1 subunit subtype-specific effects on Ca2+ channel gating." Helton T.D., Horne W.A. J. Neurosci. 22:1573-1582(2002) [PubMed: 11880487] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING. Tissue: Spinal cord. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Hippocampus. |
| [4] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "Calcium channel beta4 (CACNB4): human ortholog of the mouse epilepsy gene lethargic." Escayg A., Jones J.M., Kearney J.A., Hitchcock P.F., Meisler M.H. Genomics 50:14-22(1998) [PubMed: 9628818] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-520 (ISOFORM 1). |
| [7] | "Coding and noncoding variation of the human calcium-channel beta4-subunit gene CACNB4 in patients with idiopathic generalized epilepsy and episodic ataxia." Escayg A., De Waard M., Lee D.D., Bichet D., Wolf P., Mayer T., Johnston J., Baloh R., Sander T., Meisler M.H. Am. J. Hum. Genet. 66:1531-1539(2000) [PubMed: 10762541] [Abstract] Cited for: INVOLVEMENT IN EJM6 AND IGE9, VARIANT EA5 PHE-104. |
| [8] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed: 19807924] [Abstract] Cited for: INTERACTION WITH FASLG. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U95020 mRNA. Translation: AAB53333.1. AY054985 mRNA. Translation: AAL14351.1. AK290049 mRNA. Translation: BAF82738.1. CH471058 Genomic DNA. Translation: EAX11494.1. BC075049 mRNA. Translation: AAH75049.1. AF038852 mRNA. Translation: AAC24206.1. | ||||||||||||||||||
| IPI | IPI00011258. IPI00332347. | ||||||||||||||||||
| RefSeq | NP_000717.2. NM_000726.3. NP_001005747.1. NM_001005747.2. NP_001139270.1. NM_001145798.1. | ||||||||||||||||||
| UniGene | Hs.120725. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O00305. | ||||||||||||||||||
| SMR | O00305. Positions 50-403. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | O00305. 7 interactions. | ||||||||||||||||||
| MINT | MINT-1418672. | ||||||||||||||||||
| STRING | O00305. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| TCDB | 8.A.22.4.1. Ca2+ channel auxiliary subunit beta types 1-4 (CCA-beta) family. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O00305. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | O00305. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000339254; ENSP00000343563; ENSG00000182389. | ||||||||||||||||||
| GeneID | 785. | ||||||||||||||||||
| KEGG | hsa:785. | ||||||||||||||||||
| UCSC | uc002tya.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 785. | ||||||||||||||||||
| GeneCards | GC02M152659. | ||||||||||||||||||
| H-InvDB | HIX0023915. | ||||||||||||||||||
| HGNC | HGNC:1404. CACNB4. | ||||||||||||||||||
| HPA | HPA015601. | ||||||||||||||||||
| MIM | 601949. gene. 607682. phenotype. 613855. phenotype. | ||||||||||||||||||
| neXtProt | NX_O00305. | ||||||||||||||||||
| Orphanet | 211067. Episodic ataxia type 5. 307. Juvenile myoclonic epilepsy. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG10490. | ||||||||||||||||||
| HOGENOM | HBG445475. | ||||||||||||||||||
| HOVERGEN | HBG050765. | ||||||||||||||||||
| InParanoid | O00305. | ||||||||||||||||||
| OMA | PLVEEEY. | ||||||||||||||||||
| PhylomeDB | O00305. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_13685. Neuronal System. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O00305. | ||||||||||||||||||
| Bgee | O00305. | ||||||||||||||||||
| CleanEx | HS_CACNB4. | ||||||||||||||||||
| Genevestigator | O00305. | ||||||||||||||||||
| GermOnline | ENSG00000182389. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR001452. SH3_domain. IPR000584. VDCC_L_bsu. [Graphical view] | ||||||||||||||||||
| KO | K04865. | ||||||||||||||||||
| PANTHER | PTHR11824. Ca_channel_B. 1 hit. | ||||||||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF12052. VGCC_beta4Aa_N. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR01626. LCACHANNELB. | ||||||||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. | ||||||||||||||||||
| PROSITE | PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| DrugBank | DB00661. Verapamil. | ||||||||||||||||||
| NextBio | 3194. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CACB4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00305 Secondary accession number(s): A8K1Y4 Q96L40 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with