Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-associated progesterone receptor component 1

Gene

PGRMC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for progesterone.By similarity

GO - Molecular functioni

  • heme binding Source: GO_Central
  • steroid binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionReceptor
LigandLipid-binding, Steroid-binding

Enzyme and pathway databases

ReactomeiR-HSA-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-associated progesterone receptor component 1
Short name:
mPR
Gene namesi
Name:PGRMC1
Synonyms:HPR6.6, PGRMC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:16090. PGRMC1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 24LumenalSequence analysisAdd BLAST24
Transmembranei25 – 43HelicalSequence analysisAdd BLAST19
Topological domaini44 – 195CytoplasmicSequence analysisAdd BLAST152

GO - Cellular componenti

  • endoplasmic reticulum Source: ARUK-UCL
  • endoplasmic reticulum membrane Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
  • integral component of plasma membrane Source: ARUK-UCL
  • membrane Source: UniProtKB
  • plasma membrane Source: Reactome
  • specific granule membrane Source: Reactome

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi10857.
OpenTargetsiENSG00000101856.
PharmGKBiPA33248.

Chemistry databases

DrugBankiDB00514. Dextromethorphan.
DB00540. Nortriptyline.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001217391 – 195Membrane-associated progesterone receptor component 1Add BLAST195

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei54PhosphoserineCombined sources1
Modified residuei57PhosphoserineCombined sources1
Modified residuei74PhosphothreonineCombined sources1
Modified residuei181PhosphoserineCombined sources1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO00264.
PaxDbiO00264.
PeptideAtlasiO00264.
PRIDEiO00264.
TopDownProteomicsiO00264-1. [O00264-1]

2D gel databases

OGPiO00264.

PTM databases

iPTMnetiO00264.
PhosphoSitePlusiO00264.
SwissPalmiO00264.

Expressioni

Tissue specificityi

Widely expressed, with highest expression in liver and kidney.

Gene expression databases

BgeeiENSG00000101856.
CleanExiHS_PGRMC1.
ExpressionAtlasiO00264. baseline and differential.
GenevisibleiO00264. HS.

Organism-specific databases

HPAiHPA002877.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi116068. 49 interactors.
IntActiO00264. 56 interactors.
MINTiMINT-2997519.
STRINGi9606.ENSP00000217971.

Structurei

Secondary structure

1195
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi75 – 78Combined sources4
Beta strandi82 – 87Combined sources6
Beta strandi89 – 93Combined sources5
Beta strandi96 – 99Combined sources4
Helixi101 – 103Combined sources3
Helixi104 – 107Combined sources4
Helixi114 – 116Combined sources3
Helixi122 – 127Combined sources6
Helixi132 – 134Combined sources3
Helixi142 – 144Combined sources3
Helixi147 – 163Combined sources17
Beta strandi164 – 170Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4X8YX-ray1.95A/B72-195[»]
ProteinModelPortaliO00264.
SMRiO00264.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini72 – 171Cytochrome b5 heme-bindingAdd BLAST100

Domaini

The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 107 and 131.By similarity

Sequence similaritiesi

Belongs to the cytochrome b5 family. MAPR subfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1110. Eukaryota.
ENOG4111UG0. LUCA.
GeneTreeiENSGT00730000110959.
HOGENOMiHOG000187840.
HOVERGENiHBG059971.
InParanoidiO00264.
KOiK17278.
OMAiEWETQFT.
OrthoDBiEOG091G0PXT.
PhylomeDBiO00264.
TreeFamiTF314562.

Family and domain databases

Gene3Di3.10.120.10. 1 hit.
InterProiView protein in InterPro
IPR001199. Cyt_B5-like_heme/steroid-bd.
PfamiView protein in Pfam
PF00173. Cyt-b5. 1 hit.
SMARTiView protein in SMART
SM01117. Cyt-b5. 1 hit.
SUPFAMiSSF55856. SSF55856. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00264-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAEDVVATG ADPSDLESGG LLHEIFTSPL NLLLLGLCIF LLYKIVRGDQ
60 70 80 90 100
PAASGDSDDD EPPPLPRLKR RDFTPAELRR FDGVQDPRIL MAINGKVFDV
110 120 130 140 150
TKGRKFYGPE GPYGVFAGRD ASRGLATFCL DKEALKDEYD DLSDLTAAQQ
160 170 180 190
ETLSDWESQF TFKYHHVGKL LKEGEEPTVY SDEEEPKDES ARKND
Length:195
Mass (Da):21,671
Last modified:January 23, 2007 - v3
Checksum:iCCD5E802E1C9E604
GO
Isoform 2 (identifier: O00264-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-162: EGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTF → V

Note: No experimental confirmation available.
Show »
Length:143
Mass (Da):15,879
Checksum:i51538E8883D9E1EC
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_054710110 – 162EGPYG…SQFTF → V in isoform 2. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12711 mRNA. Translation: CAA73248.1.
AK293618 mRNA. Translation: BAH11549.1.
AC004835 Genomic DNA. No translation available.
CH471161 Genomic DNA. Translation: EAW89881.1.
BC034238 mRNA. Translation: AAH34238.1.
AJ249131 Genomic DNA. Translation: CAB65109.1.
CCDSiCCDS14576.1. [O00264-1]
CCDS65313.1. [O00264-2]
RefSeqiNP_001269550.1. NM_001282621.1. [O00264-2]
NP_006658.1. NM_006667.4. [O00264-1]
UniGeneiHs.90061.

Genome annotation databases

EnsembliENST00000217971; ENSP00000217971; ENSG00000101856. [O00264-1]
ENST00000535419; ENSP00000442821; ENSG00000101856. [O00264-2]
GeneIDi10857.
KEGGihsa:10857.
UCSCiuc011mts.4. human. [O00264-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPGRC1_HUMAN
AccessioniPrimary (citable) accession number: O00264
Secondary accession number(s): B7Z1L3, Q9UGJ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 23, 2007
Last modified: August 30, 2017
This is version 164 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families