Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O00219

- HYAS3_HUMAN

UniProt

O00219 - HYAS3_HUMAN

Protein

Hyaluronan synthase 3

Gene

HAS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 126 (01 Oct 2014)
      Sequence version 3 (23 Sep 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction By similarity.By similarity

    Catalytic activityi

    UDP-alpha-N-acetyl-D-glucosamine + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan) = UDP + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan).
    UDP-alpha-D-glucuronate + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan) = UDP + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan).

    Cofactori

    Magnesium.

    Pathwayi

    GO - Molecular functioni

    1. hyaluronan synthase activity Source: UniProtKB

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. extracellular matrix assembly Source: UniProtKB
    3. extracellular polysaccharide biosynthetic process Source: UniProtKB
    4. glycosaminoglycan metabolic process Source: Reactome
    5. hyaluronan biosynthetic process Source: UniProtKB
    6. hyaluronan metabolic process Source: Reactome
    7. positive regulation of hyaluranon cable assembly Source: UniProtKB
    8. positive regulation of transcription, DNA-templated Source: UniProtKB
    9. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Enzyme and pathway databases

    BRENDAi2.4.1.212. 2681.
    ReactomeiREACT_121301. Hyaluronan biosynthesis and export.
    UniPathwayiUPA00341.

    Protein family/group databases

    CAZyiGT2. Glycosyltransferase Family 2.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Hyaluronan synthase 3 (EC:2.4.1.212)
    Alternative name(s):
    Hyaluronate synthase 3
    Hyaluronic acid synthase 3
    Short name:
    HA synthase 3
    Gene namesi
    Name:HAS3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:4820. HAS3.

    Subcellular locationi

    GO - Cellular componenti

    1. hyaluranon cable Source: UniProtKB
    2. integral component of membrane Source: ProtInc
    3. integral component of plasma membrane Source: ProtInc
    4. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29196.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 553553Hyaluronan synthase 3PRO_0000197178Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi462 – 4621N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiO00219.
    PaxDbiO00219.
    PRIDEiO00219.

    PTM databases

    PhosphoSiteiO00219.

    Expressioni

    Gene expression databases

    ArrayExpressiO00219.
    BgeeiO00219.
    CleanExiHS_HAS3.
    GenevestigatoriO00219.

    Organism-specific databases

    HPAiCAB033850.
    HPA031554.

    Interactioni

    Protein-protein interaction databases

    BioGridi109288. 2 interactions.
    STRINGi9606.ENSP00000304440.

    Structurei

    3D structure databases

    ProteinModelPortaliO00219.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1515CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini37 – 448ExtracellularSequence Analysis
    Topological domaini66 – 377312CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini399 – 40810ExtracellularSequence Analysis
    Topological domaini430 – 44011CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini462 – 47312ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini495 – 51521CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini537 – 55317ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei16 – 3621Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei45 – 6521Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei378 – 39821Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei409 – 42921Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei441 – 46121Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei474 – 49421Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei516 – 53621Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NodC/HAS family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1215.
    HOGENOMiHOG000112847.
    HOVERGENiHBG000189.
    InParanoidiO00219.
    KOiK00752.
    OMAiFIHTEQH.
    OrthoDBiEOG77WWBZ.
    PhylomeDBiO00219.
    TreeFamiTF332506.

    Family and domain databases

    Gene3Di3.90.550.10. 2 hits.
    InterProiIPR026108. HA_synthase_3.
    IPR026107. HAS/NodC.
    IPR029044. Nucleotide-diphossugar_trans.
    [Graphical view]
    PANTHERiPTHR22913. PTHR22913. 1 hit.
    PTHR22913:SF6. PTHR22913:SF6. 1 hit.
    SUPFAMiSSF53448. SSF53448. 2 hits.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O00219-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVQLTTALR VVGTSLFALA VLGGILAAYV TGYQFIHTEK HYLSFGLYGA    50
    ILGLHLLIQS LFAFLEHRRM RRAGQALKLP SPRRGSVALC IAAYQEDPDY 100
    LRKCLRSAQR ISFPDLKVVM VVDGNRQEDA YMLDIFHEVL GGTEQAGFFV 150
    WRSNFHEAGE GETEASLQEG MDRVRDVVRA STFSCIMQKW GGKREVMYTA 200
    FKALGDSVDY IQVCDSDTVL DPACTIEMLR VLEEDPQVGG VGGDVQILNK 250
    YDSWISFLSS VRYWMAFNVE RACQSYFGCV QCISGPLGMY RNSLLQQFLE 300
    DWYHQKFLGS KCSFGDDRHL TNRVLSLGYR TKYTARSKCL TETPTKYLRW 350
    LNQQTRWSKS YFREWLYNSL WFHKHHLWMT YESVVTGFFP FFLIATVIQL 400
    FYRGRIWNIL LFLLTVQLVG IIKATYACFL RGNAEMIFMS LYSLLYMSSL 450
    LPAKIFAIAT INKSGWGTSG RKTIVVNFIG LIPVSIWVAV LLGGLAYTAY 500
    CQDLFSETEL AFLVSGAILY GCYWVALLML YLAIIARRCG KKPEQYSLAF 550
    AEV 553
    Length:553
    Mass (Da):62,998
    Last modified:September 23, 2008 - v3
    Checksum:i82F3B0C932EE9EA3
    GO
    Isoform 2 (identifier: O00219-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         247-553: ILNKYDSWIS...EQYSLAFAEV → PPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

    Note: No experimental confirmation available.

    Show »
    Length:281
    Mass (Da):31,200
    Checksum:iBD9AA4E19847764B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti493 – 4931G → E in AAF36984. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti173 – 1731R → H.
    Corresponds to variant rs2232229 [ dbSNP | Ensembl ].
    VAR_049317

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei247 – 553307ILNKY…AFAEV → PPGKGMAVEDDQVQAAQVRA TEAWSVHQRHVSREQ in isoform 2. 1 PublicationVSP_042022Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF232772 mRNA. Translation: AAF36984.1.
    AK291400 mRNA. Translation: BAF84089.1.
    AC009027 Genomic DNA. No translation available.
    CH471092 Genomic DNA. Translation: EAW83247.1.
    CH471092 Genomic DNA. Translation: EAW83248.1.
    BC021853 mRNA. Translation: AAH21853.1.
    U86409 Genomic DNA. Translation: AAC51209.1.
    CCDSiCCDS10870.1. [O00219-2]
    CCDS10871.1. [O00219-1]
    RefSeqiNP_001186209.1. NM_001199280.1. [O00219-1]
    NP_005320.2. NM_005329.2. [O00219-1]
    NP_619515.1. NM_138612.2. [O00219-2]
    XP_005255977.1. XM_005255920.2. [O00219-1]
    XP_005255978.1. XM_005255921.1. [O00219-1]
    UniGeneiHs.592069.

    Genome annotation databases

    EnsembliENST00000219322; ENSP00000219322; ENSG00000103044. [O00219-2]
    ENST00000306560; ENSP00000304440; ENSG00000103044. [O00219-1]
    ENST00000569188; ENSP00000454731; ENSG00000103044. [O00219-1]
    GeneIDi3038.
    KEGGihsa:3038.
    UCSCiuc002ewk.3. human. [O00219-2]
    uc002ewl.3. human. [O00219-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    GGDB

    GlycoGene database

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF232772 mRNA. Translation: AAF36984.1 .
    AK291400 mRNA. Translation: BAF84089.1 .
    AC009027 Genomic DNA. No translation available.
    CH471092 Genomic DNA. Translation: EAW83247.1 .
    CH471092 Genomic DNA. Translation: EAW83248.1 .
    BC021853 mRNA. Translation: AAH21853.1 .
    U86409 Genomic DNA. Translation: AAC51209.1 .
    CCDSi CCDS10870.1. [O00219-2 ]
    CCDS10871.1. [O00219-1 ]
    RefSeqi NP_001186209.1. NM_001199280.1. [O00219-1 ]
    NP_005320.2. NM_005329.2. [O00219-1 ]
    NP_619515.1. NM_138612.2. [O00219-2 ]
    XP_005255977.1. XM_005255920.2. [O00219-1 ]
    XP_005255978.1. XM_005255921.1. [O00219-1 ]
    UniGenei Hs.592069.

    3D structure databases

    ProteinModelPortali O00219.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109288. 2 interactions.
    STRINGi 9606.ENSP00000304440.

    Protein family/group databases

    CAZyi GT2. Glycosyltransferase Family 2.

    PTM databases

    PhosphoSitei O00219.

    Proteomic databases

    MaxQBi O00219.
    PaxDbi O00219.
    PRIDEi O00219.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000219322 ; ENSP00000219322 ; ENSG00000103044 . [O00219-2 ]
    ENST00000306560 ; ENSP00000304440 ; ENSG00000103044 . [O00219-1 ]
    ENST00000569188 ; ENSP00000454731 ; ENSG00000103044 . [O00219-1 ]
    GeneIDi 3038.
    KEGGi hsa:3038.
    UCSCi uc002ewk.3. human. [O00219-2 ]
    uc002ewl.3. human. [O00219-1 ]

    Organism-specific databases

    CTDi 3038.
    GeneCardsi GC16P069140.
    HGNCi HGNC:4820. HAS3.
    HPAi CAB033850.
    HPA031554.
    MIMi 602428. gene.
    neXtProti NX_O00219.
    PharmGKBi PA29196.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1215.
    HOGENOMi HOG000112847.
    HOVERGENi HBG000189.
    InParanoidi O00219.
    KOi K00752.
    OMAi FIHTEQH.
    OrthoDBi EOG77WWBZ.
    PhylomeDBi O00219.
    TreeFami TF332506.

    Enzyme and pathway databases

    UniPathwayi UPA00341 .
    BRENDAi 2.4.1.212. 2681.
    Reactomei REACT_121301. Hyaluronan biosynthesis and export.

    Miscellaneous databases

    GeneWikii HAS3.
    GenomeRNAii 3038.
    NextBioi 12028.
    PROi O00219.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O00219.
    Bgeei O00219.
    CleanExi HS_HAS3.
    Genevestigatori O00219.

    Family and domain databases

    Gene3Di 3.90.550.10. 2 hits.
    InterProi IPR026108. HA_synthase_3.
    IPR026107. HAS/NodC.
    IPR029044. Nucleotide-diphossugar_trans.
    [Graphical view ]
    PANTHERi PTHR22913. PTHR22913. 1 hit.
    PTHR22913:SF6. PTHR22913:SF6. 1 hit.
    SUPFAMi SSF53448. SSF53448. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular characterization of hyaluronan synthase 3."
      Spicer A.P.
      Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Prostate.
    6. "Molecular cloning and characterization of a cDNA encoding the third putative mammalian hyaluronan synthase."
      Spicer A.P., Olson J.S., McDonald J.A.
      J. Biol. Chem. 272:8957-8961(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 275-464.

    Entry informationi

    Entry nameiHYAS3_HUMAN
    AccessioniPrimary (citable) accession number: O00219
    Secondary accession number(s): A8K5T5, Q8WTZ0, Q9NYP0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: September 23, 2008
    Last modified: October 1, 2014
    This is version 126 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3