Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hyaluronan synthase 3

Gene

HAS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction (By similarity).By similarity

Catalytic activityi

UDP-alpha-N-acetyl-D-glucosamine + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan) = UDP + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan).
UDP-alpha-D-glucuronate + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan) = UDP + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan).

Cofactori

Pathwayi: hyaluronan biosynthesis

This protein is involved in the pathway hyaluronan biosynthesis, which is part of Glycan biosynthesis.
View all proteins of this organism that are known to be involved in the pathway hyaluronan biosynthesis and in Glycan biosynthesis.

GO - Molecular functioni

  • hyaluronan synthase activity Source: UniProtKB

GO - Biological processi

  • carbohydrate metabolic process Source: ProtInc
  • cell adhesion Source: GO_Central
  • extracellular matrix assembly Source: UniProtKB
  • extracellular polysaccharide biosynthetic process Source: UniProtKB
  • hyaluronan biosynthetic process Source: UniProtKB
  • positive regulation of hyaluranon cable assembly Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BioCyciZFISH:HS02447-MONOMER.
BRENDAi2.4.1.212. 2681.
ReactomeiR-HSA-2142850. Hyaluronan biosynthesis and export.
UniPathwayiUPA00341.

Protein family/group databases

CAZyiGT2. Glycosyltransferase Family 2.

Names & Taxonomyi

Protein namesi
Recommended name:
Hyaluronan synthase 3 (EC:2.4.1.212)
Alternative name(s):
Hyaluronate synthase 3
Hyaluronic acid synthase 3
Short name:
HA synthase 3
Gene namesi
Name:HAS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:4820. HAS3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 15CytoplasmicSequence analysisAdd BLAST15
Transmembranei16 – 36Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini37 – 44ExtracellularSequence analysis8
Transmembranei45 – 65Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini66 – 377CytoplasmicSequence analysisAdd BLAST312
Transmembranei378 – 398Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini399 – 408ExtracellularSequence analysis10
Transmembranei409 – 429Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini430 – 440CytoplasmicSequence analysisAdd BLAST11
Transmembranei441 – 461Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini462 – 473ExtracellularSequence analysisAdd BLAST12
Transmembranei474 – 494Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini495 – 515CytoplasmicSequence analysisAdd BLAST21
Transmembranei516 – 536Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini537 – 553ExtracellularSequence analysisAdd BLAST17

GO - Cellular componenti

  • cytoplasm Source: Ensembl
  • hyaluranon cable Source: UniProtKB
  • integral component of membrane Source: ProtInc
  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3038.
OpenTargetsiENSG00000103044.
PharmGKBiPA29196.

Polymorphism and mutation databases

BioMutaiHAS3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001971781 – 553Hyaluronan synthase 3Add BLAST553

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi462N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiO00219.
PaxDbiO00219.
PeptideAtlasiO00219.
PRIDEiO00219.

PTM databases

iPTMnetiO00219.
PhosphoSitePlusiO00219.

Expressioni

Gene expression databases

BgeeiENSG00000103044.
CleanExiHS_HAS3.
ExpressionAtlasiO00219. baseline and differential.
GenevisibleiO00219. HS.

Organism-specific databases

HPAiCAB033850.
HPA031554.

Interactioni

Protein-protein interaction databases

BioGridi109288. 2 interactors.
STRINGi9606.ENSP00000304440.

Structurei

3D structure databases

ProteinModelPortaliO00219.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NodC/HAS family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2571. Eukaryota.
COG1215. LUCA.
GeneTreeiENSGT00390000010337.
HOGENOMiHOG000112847.
HOVERGENiHBG000189.
InParanoidiO00219.
KOiK00752.
OMAiRGRLWNI.
OrthoDBiEOG091G04P3.
PhylomeDBiO00219.
TreeFamiTF332506.

Family and domain databases

Gene3Di3.90.550.10. 2 hits.
InterProiIPR026108. HA_synthase_3.
IPR026107. HAS/NodC.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view]
PANTHERiPTHR22913. PTHR22913. 1 hit.
PTHR22913:SF6. PTHR22913:SF6. 1 hit.
SUPFAMiSSF53448. SSF53448. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00219-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVQLTTALR VVGTSLFALA VLGGILAAYV TGYQFIHTEK HYLSFGLYGA
60 70 80 90 100
ILGLHLLIQS LFAFLEHRRM RRAGQALKLP SPRRGSVALC IAAYQEDPDY
110 120 130 140 150
LRKCLRSAQR ISFPDLKVVM VVDGNRQEDA YMLDIFHEVL GGTEQAGFFV
160 170 180 190 200
WRSNFHEAGE GETEASLQEG MDRVRDVVRA STFSCIMQKW GGKREVMYTA
210 220 230 240 250
FKALGDSVDY IQVCDSDTVL DPACTIEMLR VLEEDPQVGG VGGDVQILNK
260 270 280 290 300
YDSWISFLSS VRYWMAFNVE RACQSYFGCV QCISGPLGMY RNSLLQQFLE
310 320 330 340 350
DWYHQKFLGS KCSFGDDRHL TNRVLSLGYR TKYTARSKCL TETPTKYLRW
360 370 380 390 400
LNQQTRWSKS YFREWLYNSL WFHKHHLWMT YESVVTGFFP FFLIATVIQL
410 420 430 440 450
FYRGRIWNIL LFLLTVQLVG IIKATYACFL RGNAEMIFMS LYSLLYMSSL
460 470 480 490 500
LPAKIFAIAT INKSGWGTSG RKTIVVNFIG LIPVSIWVAV LLGGLAYTAY
510 520 530 540 550
CQDLFSETEL AFLVSGAILY GCYWVALLML YLAIIARRCG KKPEQYSLAF

AEV
Length:553
Mass (Da):62,998
Last modified:September 23, 2008 - v3
Checksum:i82F3B0C932EE9EA3
GO
Isoform 2 (identifier: O00219-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-553: ILNKYDSWIS...EQYSLAFAEV → PPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):31,200
Checksum:iBD9AA4E19847764B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti493G → E in AAF36984 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049317173R → H.Corresponds to variant rs2232229dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042022247 – 553ILNKY…AFAEV → PPGKGMAVEDDQVQAAQVRA TEAWSVHQRHVSREQ in isoform 2. 1 PublicationAdd BLAST307

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF232772 mRNA. Translation: AAF36984.1.
AK291400 mRNA. Translation: BAF84089.1.
AC009027 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83247.1.
CH471092 Genomic DNA. Translation: EAW83248.1.
BC021853 mRNA. Translation: AAH21853.1.
U86409 Genomic DNA. Translation: AAC51209.1.
CCDSiCCDS10870.1. [O00219-2]
CCDS10871.1. [O00219-1]
RefSeqiNP_001186209.1. NM_001199280.1. [O00219-1]
NP_005320.2. NM_005329.2. [O00219-1]
NP_619515.1. NM_138612.2. [O00219-2]
XP_005255978.1. XM_005255921.2. [O00219-1]
XP_011521363.1. XM_011523061.2. [O00219-1]
UniGeneiHs.592069.

Genome annotation databases

EnsembliENST00000219322; ENSP00000219322; ENSG00000103044. [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044. [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044. [O00219-1]
GeneIDi3038.
KEGGihsa:3038.
UCSCiuc002ewk.4. human. [O00219-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF232772 mRNA. Translation: AAF36984.1.
AK291400 mRNA. Translation: BAF84089.1.
AC009027 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83247.1.
CH471092 Genomic DNA. Translation: EAW83248.1.
BC021853 mRNA. Translation: AAH21853.1.
U86409 Genomic DNA. Translation: AAC51209.1.
CCDSiCCDS10870.1. [O00219-2]
CCDS10871.1. [O00219-1]
RefSeqiNP_001186209.1. NM_001199280.1. [O00219-1]
NP_005320.2. NM_005329.2. [O00219-1]
NP_619515.1. NM_138612.2. [O00219-2]
XP_005255978.1. XM_005255921.2. [O00219-1]
XP_011521363.1. XM_011523061.2. [O00219-1]
UniGeneiHs.592069.

3D structure databases

ProteinModelPortaliO00219.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109288. 2 interactors.
STRINGi9606.ENSP00000304440.

Protein family/group databases

CAZyiGT2. Glycosyltransferase Family 2.

PTM databases

iPTMnetiO00219.
PhosphoSitePlusiO00219.

Polymorphism and mutation databases

BioMutaiHAS3.

Proteomic databases

MaxQBiO00219.
PaxDbiO00219.
PeptideAtlasiO00219.
PRIDEiO00219.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000219322; ENSP00000219322; ENSG00000103044. [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044. [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044. [O00219-1]
GeneIDi3038.
KEGGihsa:3038.
UCSCiuc002ewk.4. human. [O00219-1]

Organism-specific databases

CTDi3038.
DisGeNETi3038.
GeneCardsiHAS3.
HGNCiHGNC:4820. HAS3.
HPAiCAB033850.
HPA031554.
MIMi602428. gene.
neXtProtiNX_O00219.
OpenTargetsiENSG00000103044.
PharmGKBiPA29196.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2571. Eukaryota.
COG1215. LUCA.
GeneTreeiENSGT00390000010337.
HOGENOMiHOG000112847.
HOVERGENiHBG000189.
InParanoidiO00219.
KOiK00752.
OMAiRGRLWNI.
OrthoDBiEOG091G04P3.
PhylomeDBiO00219.
TreeFamiTF332506.

Enzyme and pathway databases

UniPathwayiUPA00341.
BioCyciZFISH:HS02447-MONOMER.
BRENDAi2.4.1.212. 2681.
ReactomeiR-HSA-2142850. Hyaluronan biosynthesis and export.

Miscellaneous databases

GeneWikiiHAS3.
GenomeRNAii3038.
PROiO00219.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000103044.
CleanExiHS_HAS3.
ExpressionAtlasiO00219. baseline and differential.
GenevisibleiO00219. HS.

Family and domain databases

Gene3Di3.90.550.10. 2 hits.
InterProiIPR026108. HA_synthase_3.
IPR026107. HAS/NodC.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view]
PANTHERiPTHR22913. PTHR22913. 1 hit.
PTHR22913:SF6. PTHR22913:SF6. 1 hit.
SUPFAMiSSF53448. SSF53448. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiHYAS3_HUMAN
AccessioniPrimary (citable) accession number: O00219
Secondary accession number(s): A8K5T5, Q8WTZ0, Q9NYP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 23, 2008
Last modified: November 2, 2016
This is version 145 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.