SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O00219

- HYAS3_HUMAN

UniProt

O00219 - HYAS3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Hyaluronan synthase 3

Gene
HAS3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction By similarity.

Catalytic activityi

UDP-alpha-N-acetyl-D-glucosamine + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan) = UDP + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-(nascent hyaluronan).
UDP-alpha-D-glucuronate + N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan) = UDP + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-(nascent hyaluronan).

Cofactori

Magnesium.

Pathwayi

GO - Molecular functioni

  1. hyaluronan synthase activity Source: UniProtKB

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. extracellular matrix assembly Source: UniProtKB
  3. extracellular polysaccharide biosynthetic process Source: UniProtKB
  4. glycosaminoglycan metabolic process Source: Reactome
  5. hyaluronan biosynthetic process Source: UniProtKB
  6. hyaluronan metabolic process Source: Reactome
  7. positive regulation of hyaluranon cable assembly Source: UniProtKB
  8. positive regulation of transcription, DNA-templated Source: UniProtKB
  9. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.212. 2681.
ReactomeiREACT_121301. Hyaluronan biosynthesis and export.
UniPathwayiUPA00341.

Protein family/group databases

CAZyiGT2. Glycosyltransferase Family 2.

Names & Taxonomyi

Protein namesi
Recommended name:
Hyaluronan synthase 3 (EC:2.4.1.212)
Alternative name(s):
Hyaluronate synthase 3
Hyaluronic acid synthase 3
Short name:
HA synthase 3
Gene namesi
Name:HAS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:4820. HAS3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1515Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei16 – 3621Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini37 – 448Extracellular Reviewed prediction
Transmembranei45 – 6521Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini66 – 377312Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei378 – 39821Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini399 – 40810Extracellular Reviewed prediction
Transmembranei409 – 42921Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini430 – 44011Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei441 – 46121Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini462 – 47312Extracellular Reviewed predictionAdd
BLAST
Transmembranei474 – 49421Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini495 – 51521Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei516 – 53621Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini537 – 55317Extracellular Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. hyaluranon cable Source: UniProtKB
  2. integral component of membrane Source: ProtInc
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29196.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 553553Hyaluronan synthase 3PRO_0000197178Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi462 – 4621N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiO00219.
PaxDbiO00219.
PRIDEiO00219.

PTM databases

PhosphoSiteiO00219.

Expressioni

Gene expression databases

ArrayExpressiO00219.
BgeeiO00219.
CleanExiHS_HAS3.
GenevestigatoriO00219.

Organism-specific databases

HPAiCAB033850.
HPA031554.

Interactioni

Protein-protein interaction databases

BioGridi109288. 2 interactions.
STRINGi9606.ENSP00000304440.

Structurei

3D structure databases

ProteinModelPortaliO00219.

Family & Domainsi

Sequence similaritiesi

Belongs to the NodC/HAS family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1215.
HOGENOMiHOG000112847.
HOVERGENiHBG000189.
InParanoidiO00219.
KOiK00752.
OMAiFIHTEQH.
OrthoDBiEOG77WWBZ.
PhylomeDBiO00219.
TreeFamiTF332506.

Family and domain databases

Gene3Di3.90.550.10. 2 hits.
InterProiIPR026108. HA_synthase_3.
IPR026107. HAS/NodC.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view]
PANTHERiPTHR22913. PTHR22913. 1 hit.
PTHR22913:SF6. PTHR22913:SF6. 1 hit.
SUPFAMiSSF53448. SSF53448. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O00219-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPVQLTTALR VVGTSLFALA VLGGILAAYV TGYQFIHTEK HYLSFGLYGA    50
ILGLHLLIQS LFAFLEHRRM RRAGQALKLP SPRRGSVALC IAAYQEDPDY 100
LRKCLRSAQR ISFPDLKVVM VVDGNRQEDA YMLDIFHEVL GGTEQAGFFV 150
WRSNFHEAGE GETEASLQEG MDRVRDVVRA STFSCIMQKW GGKREVMYTA 200
FKALGDSVDY IQVCDSDTVL DPACTIEMLR VLEEDPQVGG VGGDVQILNK 250
YDSWISFLSS VRYWMAFNVE RACQSYFGCV QCISGPLGMY RNSLLQQFLE 300
DWYHQKFLGS KCSFGDDRHL TNRVLSLGYR TKYTARSKCL TETPTKYLRW 350
LNQQTRWSKS YFREWLYNSL WFHKHHLWMT YESVVTGFFP FFLIATVIQL 400
FYRGRIWNIL LFLLTVQLVG IIKATYACFL RGNAEMIFMS LYSLLYMSSL 450
LPAKIFAIAT INKSGWGTSG RKTIVVNFIG LIPVSIWVAV LLGGLAYTAY 500
CQDLFSETEL AFLVSGAILY GCYWVALLML YLAIIARRCG KKPEQYSLAF 550
AEV 553
Length:553
Mass (Da):62,998
Last modified:September 23, 2008 - v3
Checksum:i82F3B0C932EE9EA3
GO
Isoform 2 (identifier: O00219-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-553: ILNKYDSWIS...EQYSLAFAEV → PPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Note: No experimental confirmation available.

Show »
Length:281
Mass (Da):31,200
Checksum:iBD9AA4E19847764B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti173 – 1731R → H.
Corresponds to variant rs2232229 [ dbSNP | Ensembl ].
VAR_049317

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei247 – 553307ILNKY…AFAEV → PPGKGMAVEDDQVQAAQVRA TEAWSVHQRHVSREQ in isoform 2. VSP_042022Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti493 – 4931G → E in AAF36984. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF232772 mRNA. Translation: AAF36984.1.
AK291400 mRNA. Translation: BAF84089.1.
AC009027 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83247.1.
CH471092 Genomic DNA. Translation: EAW83248.1.
BC021853 mRNA. Translation: AAH21853.1.
U86409 Genomic DNA. Translation: AAC51209.1.
CCDSiCCDS10870.1. [O00219-2]
CCDS10871.1. [O00219-1]
RefSeqiNP_001186209.1. NM_001199280.1. [O00219-1]
NP_005320.2. NM_005329.2. [O00219-1]
NP_619515.1. NM_138612.2. [O00219-2]
XP_005255977.1. XM_005255920.2. [O00219-1]
XP_005255978.1. XM_005255921.1. [O00219-1]
UniGeneiHs.592069.

Genome annotation databases

EnsembliENST00000219322; ENSP00000219322; ENSG00000103044. [O00219-2]
ENST00000306560; ENSP00000304440; ENSG00000103044. [O00219-1]
ENST00000569188; ENSP00000454731; ENSG00000103044. [O00219-1]
GeneIDi3038.
KEGGihsa:3038.
UCSCiuc002ewk.3. human. [O00219-2]
uc002ewl.3. human. [O00219-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

GGDB

GlycoGene database

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF232772 mRNA. Translation: AAF36984.1 .
AK291400 mRNA. Translation: BAF84089.1 .
AC009027 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83247.1 .
CH471092 Genomic DNA. Translation: EAW83248.1 .
BC021853 mRNA. Translation: AAH21853.1 .
U86409 Genomic DNA. Translation: AAC51209.1 .
CCDSi CCDS10870.1. [O00219-2 ]
CCDS10871.1. [O00219-1 ]
RefSeqi NP_001186209.1. NM_001199280.1. [O00219-1 ]
NP_005320.2. NM_005329.2. [O00219-1 ]
NP_619515.1. NM_138612.2. [O00219-2 ]
XP_005255977.1. XM_005255920.2. [O00219-1 ]
XP_005255978.1. XM_005255921.1. [O00219-1 ]
UniGenei Hs.592069.

3D structure databases

ProteinModelPortali O00219.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109288. 2 interactions.
STRINGi 9606.ENSP00000304440.

Protein family/group databases

CAZyi GT2. Glycosyltransferase Family 2.

PTM databases

PhosphoSitei O00219.

Proteomic databases

MaxQBi O00219.
PaxDbi O00219.
PRIDEi O00219.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000219322 ; ENSP00000219322 ; ENSG00000103044 . [O00219-2 ]
ENST00000306560 ; ENSP00000304440 ; ENSG00000103044 . [O00219-1 ]
ENST00000569188 ; ENSP00000454731 ; ENSG00000103044 . [O00219-1 ]
GeneIDi 3038.
KEGGi hsa:3038.
UCSCi uc002ewk.3. human. [O00219-2 ]
uc002ewl.3. human. [O00219-1 ]

Organism-specific databases

CTDi 3038.
GeneCardsi GC16P069140.
HGNCi HGNC:4820. HAS3.
HPAi CAB033850.
HPA031554.
MIMi 602428. gene.
neXtProti NX_O00219.
PharmGKBi PA29196.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1215.
HOGENOMi HOG000112847.
HOVERGENi HBG000189.
InParanoidi O00219.
KOi K00752.
OMAi FIHTEQH.
OrthoDBi EOG77WWBZ.
PhylomeDBi O00219.
TreeFami TF332506.

Enzyme and pathway databases

UniPathwayi UPA00341 .
BRENDAi 2.4.1.212. 2681.
Reactomei REACT_121301. Hyaluronan biosynthesis and export.

Miscellaneous databases

GeneWikii HAS3.
GenomeRNAii 3038.
NextBioi 12028.
PROi O00219.
SOURCEi Search...

Gene expression databases

ArrayExpressi O00219.
Bgeei O00219.
CleanExi HS_HAS3.
Genevestigatori O00219.

Family and domain databases

Gene3Di 3.90.550.10. 2 hits.
InterProi IPR026108. HA_synthase_3.
IPR026107. HAS/NodC.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view ]
PANTHERi PTHR22913. PTHR22913. 1 hit.
PTHR22913:SF6. PTHR22913:SF6. 1 hit.
SUPFAMi SSF53448. SSF53448. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of hyaluronan synthase 3."
    Spicer A.P.
    Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Prostate.
  6. "Molecular cloning and characterization of a cDNA encoding the third putative mammalian hyaluronan synthase."
    Spicer A.P., Olson J.S., McDonald J.A.
    J. Biol. Chem. 272:8957-8961(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 275-464.

Entry informationi

Entry nameiHYAS3_HUMAN
AccessioniPrimary (citable) accession number: O00219
Secondary accession number(s): A8K5T5, Q8WTZ0, Q9NYP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 23, 2008
Last modified: September 3, 2014
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi