Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Galectin-8

Gene

LGALS8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy (PubMed:22246324, PubMed:28077878). Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture (PubMed:22246324, PubMed:28077878). Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52 (PubMed:22246324, PubMed:28077878). Required to restrict infection of bacterial invasion such as S.typhimurium (PubMed:22246324). Also required to restrict infection of Picornaviridae viruses (PubMed:28077878). Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans (PubMed:21288902).3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei59Critical for binding to sialylated and sulfated oligosaccharides1 Publication1
Binding sitei69Carbohydrate1 Publication1
Binding sitei79Carbohydrate1 Publication1
Binding sitei89Carbohydrate1 Publication1

GO - Molecular functioni

  • carbohydrate binding Source: GO_Central
  • integrin binding Source: UniProtKB

GO - Biological processi

  • cellular response to virus Source: UniProtKB
  • lymphatic endothelial cell migration Source: UniProtKB
  • xenophagy Source: UniProtKB

Keywordsi

Biological processAutophagy
LigandLectin

Names & Taxonomyi

Protein namesi
Recommended name:
Galectin-81 Publication
Short name:
Gal-8
Alternative name(s):
Po66 carbohydrate-binding protein
Short name:
Po66-CBP
Prostate carcinoma tumor antigen 11 Publication
Short name:
PCTA-11 Publication
Gene namesi
Name:LGALS8Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:6569. LGALS8.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytoplasmic vesicle Source: UniProtKB-KW
  • cytosol Source: GO_Central
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: ProtInc
  • membrane Source: UniProtKB

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi69R → H: Abolishes localization to cytoplasmic vesicles in case of infection by S.typhimurium. 1 Publication1
Mutagenesisi190R → H: Does not affect localization to cytoplasmic vesicles in case of infection by S.typhimurium. 1 Publication1

Organism-specific databases

DisGeNETi3964.
OpenTargetsiENSG00000116977.
PharmGKBiPA30346.

Chemistry databases

ChEMBLiCHEMBL5475.

Polymorphism and mutation databases

BioMutaiLGALS8.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000769431 – 317Galectin-8Add BLAST317

Proteomic databases

EPDiO00214.
MaxQBiO00214.
PeptideAtlasiO00214.
PRIDEiO00214.

PTM databases

iPTMnetiO00214.
PhosphoSitePlusiO00214.

Expressioni

Tissue specificityi

Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.

Gene expression databases

BgeeiENSG00000116977.
ExpressionAtlasiO00214. baseline and differential.
GenevisibleiO00214. HS.

Organism-specific databases

HPAiHPA012734.
HPA030491.

Interactioni

Subunit structurei

Homodimer (PubMed:21288902, Ref. 14). Interacts with CALCOCO2/NDP52 (PubMed:22246324).3 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • integrin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi110155. 107 interactors.
IntActiO00214. 8 interactors.
MINTiMINT-1458207.

Chemistry databases

BindingDBiO00214.

Structurei

Secondary structure

1317
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi4 – 6Combined sources3
Beta strandi9 – 14Combined sources6
Beta strandi17 – 22Combined sources6
Beta strandi32 – 38Combined sources7
Beta strandi44 – 53Combined sources10
Turni56 – 59Combined sources4
Beta strandi61 – 69Combined sources9
Beta strandi75 – 82Combined sources8
Beta strandi90 – 92Combined sources3
Beta strandi102 – 109Combined sources8
Beta strandi111 – 118Combined sources8
Beta strandi121 – 127Combined sources7
Helixi132 – 134Combined sources3
Beta strandi137 – 143Combined sources7
Beta strandi145 – 152Combined sources8
Beta strandi186 – 190Combined sources5
Turni196 – 198Combined sources3
Beta strandi200 – 207Combined sources8
Beta strandi213 – 220Combined sources8
Turni221 – 224Combined sources4
Beta strandi225 – 233Combined sources9
Turni234 – 237Combined sources4
Beta strandi238 – 245Combined sources8
Beta strandi254 – 256Combined sources3
Beta strandi266 – 273Combined sources8
Beta strandi275 – 282Combined sources8
Beta strandi285 – 291Combined sources7
Helixi297 – 299Combined sources3
Beta strandi302 – 317Combined sources16

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRONMR-A176-317[»]
2YV8X-ray1.92A1-152[»]
2YXSX-ray2.13A1-152[»]
3AP4X-ray2.33A/B/C/D1-154[»]
3AP5X-ray1.92A1-154[»]
3AP6X-ray1.58A/B/C/D1-154[»]
3AP7X-ray1.53A1-154[»]
3AP9X-ray1.33A1-154[»]
3APBX-ray1.95A/B1-154[»]
3OJBX-ray3.01A/B/C/D186-315[»]
3VKLX-ray2.55A/B1-155[»]
A/B184-317[»]
3VKMX-ray2.98A/B1-155[»]
A/B184-317[»]
3VKNX-ray1.98A/B1-153[»]
3VKOX-ray2.08A/B1-153[»]
4BMBX-ray1.35A4-153[»]
4BMEX-ray2.00A/B4-155[»]
4FQZX-ray2.80A1-155[»]
A184-317[»]
4GXLX-ray2.02A186-317[»]
4HANX-ray2.55A/B1-155[»]
A/B184-317[»]
5GZCX-ray1.08A7-158[»]
5GZDX-ray1.19A7-154[»]
5GZEX-ray1.32A7-154[»]
5GZFX-ray2.00A1-186[»]
5GZGX-ray2.00A1-186[»]
5T7IX-ray2.00A1-155[»]
5T7SX-ray1.90A1-155[»]
5T7TX-ray1.96A1-155[»]
5T7UX-ray1.58A1-155[»]
ProteinModelPortaliO00214.
SMRiO00214.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00214.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 152Galectin 1PROSITE-ProRule annotationAdd BLAST134
Domaini187 – 317Galectin 2PROSITE-ProRule annotationAdd BLAST131

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni249 – 255Beta-galactoside bindingBy similarity7

Domaini

Contains two homologous but distinct carbohydrate-binding domains.

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00760000119105.
HOVERGENiHBG002412.
InParanoidiO00214.
KOiK06832.
OMAiHASDYFK.
OrthoDBiEOG091G0WP8.
PhylomeDBiO00214.
TreeFamiTF315551.

Family and domain databases

InterProiView protein in InterPro
IPR013320. ConA-like_dom.
IPR030638. Galectin_8.
IPR001079. Galectin_CRD.
PANTHERiPTHR11346:SF125. PTHR11346:SF125. 1 hit.
PfamiView protein in Pfam
PF00337. Gal-bind_lectin. 2 hits.
SMARTiView protein in SMART
SM00908. Gal-bind_lectin. 2 hits.
SM00276. GLECT. 2 hits.
SUPFAMiSSF49899. SSF49899. 2 hits.
PROSITEiView protein in PROSITE
PS51304. GALECTIN. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00214-1) [UniParc]FASTAAdd to basket
Also known as: I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMLSLNNLQN IIYNPVIPFV GTIPDQLDPG TLIVIRGHVP SDADRFQVDL
60 70 80 90 100
QNGSSMKPRA DVAFHFNPRF KRAGCIVCNT LINEKWGREE ITYDTPFKRE
110 120 130 140 150
KSFEIVIMVL KDKFQVAVNG KHTLLYGHRI GPEKIDTLGI YGKVNIHSIG
160 170 180 190 200
FSFSSDLQST QASSLELTEI SRENVPKSGT PQLRLPFAAR LNTPMGPGRT
210 220 230 240 250
VVVKGEVNAN AKSFNVDLLA GKSKDIALHL NPRLNIKAFV RNSFLQESWG
260 270 280 290 300
EEERNITSFP FSPGMYFEMI IYCDVREFKV AVNGVHSLEY KHRFKELSSI
310
DTLEINGDIH LLEVRSW
Length:317
Mass (Da):35,808
Last modified:March 23, 2010 - v4
Checksum:iAA13116AC5C0D69A
GO
Isoform 2 (identifier: O00214-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: L → LPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSK

Show »
Length:359
Mass (Da):40,397
Checksum:i39BED76B4115A798
GO

Sequence cautioni

The sequence AAB51605 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45402 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45403 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAD45404 differs from that shown. Probable cloning artifact.Curated
The sequence AAD45404 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH15818 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH16486 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14N → S in AAL77076 (Ref. 8) Curated1
Sequence conflicti98 – 100KRE → QKEK in CAA62904 (Ref. 2) Curated3
Sequence conflicti112D → A in CAA62904 (Ref. 2) Curated1
Sequence conflicti171S → V in AAB51605 (PubMed:8692978).Curated1
Sequence conflicti199R → G in AAL77076 (Ref. 8) Curated1
Sequence conflicti204K → Q in AAB51605 (PubMed:8692978).Curated1
Sequence conflicti225D → H in AAL77076 (Ref. 8) Curated1
Sequence conflicti259F → L in AAK16736 (Ref. 7) Curated1
Isoform 2 (identifier: O00214-2)
Sequence conflicti220M → T in AAL77076 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01299019F → Y4 PublicationsCorresponds to variant dbSNP:rs2737713Ensembl.1
Natural variantiVAR_00971036R → C4 PublicationsCorresponds to variant dbSNP:rs1041935Ensembl.1
Natural variantiVAR_01299156M → V5 PublicationsCorresponds to variant dbSNP:rs1041937Ensembl.1
Natural variantiVAR_063506184R → S4 PublicationsCorresponds to variant dbSNP:rs2243525Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003094183L → LPSNRGGDISKIAPRTVYTK SKDSTVNHTLTCTKIPPMNY VSK in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L78132 mRNA. Translation: AAB51605.1. Different initiation.
X91790 mRNA. Translation: CAA62904.1.
AF074000 mRNA. Translation: AAD45402.1. Different initiation.
AF074001 mRNA. Translation: AAD45403.1. Different initiation.
AF074002 mRNA. Translation: AAD45404.1. Sequence problems.
AF193806, AF193805 Genomic DNA. Translation: AAF19370.1.
AF342815 mRNA. Translation: AAK16735.1.
AF342816 mRNA. Translation: AAK16736.1.
AF468213 mRNA. Translation: AAL77076.1.
AL359921 Genomic DNA. Translation: CAI13773.1.
AL359921 Genomic DNA. Translation: CAI13774.1.
BC015818 mRNA. Translation: AAH15818.1. Different initiation.
BC016486 mRNA. Translation: AAH16486.2. Different initiation.
CCDSiCCDS1611.1. [O00214-2]
CCDS1612.1. [O00214-1]
PIRiJC6147.
RefSeqiNP_006490.3. NM_006499.4. [O00214-2]
NP_963837.1. NM_201543.2. [O00214-1]
NP_963838.1. NM_201544.2. [O00214-1]
NP_963839.1. NM_201545.2. [O00214-2]
UniGeneiHs.4082.
Hs.708114.
Hs.735982.

Genome annotation databases

EnsembliENST00000341872; ENSP00000342139; ENSG00000116977. [O00214-1]
ENST00000352231; ENSP00000309576; ENSG00000116977. [O00214-2]
ENST00000366584; ENSP00000355543; ENSG00000116977. [O00214-1]
ENST00000450372; ENSP00000408657; ENSG00000116977. [O00214-2]
ENST00000526589; ENSP00000435460; ENSG00000116977. [O00214-2]
ENST00000526634; ENSP00000437040; ENSG00000116977. [O00214-1]
ENST00000527974; ENSP00000431398; ENSG00000116977. [O00214-2]
GeneIDi3964.
KEGGihsa:3964.
UCSCiuc001hxw.3. human. [O00214-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiLEG8_HUMAN
AccessioniPrimary (citable) accession number: O00214
Secondary accession number(s): O15215
, Q5T3P5, Q5T3Q4, Q8TEV1, Q96B92, Q9BXC8, Q9H584, Q9H585, Q9UEZ6, Q9UP32, Q9UP33, Q9UP34
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 23, 2010
Last modified: July 5, 2017
This is version 166 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references