Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O00214 (LEG8_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Galectin-8

Short name=Gal-8
Alternative name(s):
Po66 carbohydrate-binding protein
Short name=Po66-CBP
Prostate carcinoma tumor antigen 1
Short name=PCTA-1
Gene names
Name:LGALS8
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length317 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans. Ref.13

Subunit structure

Homodimer. Ref.13

Subcellular location

Cytoplasm Probable.

Tissue specificity

Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.

Domain

Contains two homologous but distinct carbohydrate-binding domains.

Sequence similarities

Contains 2 galectin domains.

Sequence caution

The sequence AAB51605.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD45402.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD45403.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD45404.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAD45404.1 differs from that shown. Reason: Probable cloning artifact.

The sequence AAH15818.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAH16486.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
   LigandLectin
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processT cell costimulation

Inferred from electronic annotation. Source: Ensembl

plasma cell differentiation

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

extracellular space

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functioncarbohydrate binding

Traceable author statement Ref.1. Source: ProtInc

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

TGIF1Q1558310EBI-740058,EBI-714215

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O00214-1)

Also known as: I;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O00214-2)

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: L → LPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 317317Galectin-8
PRO_0000076943

Regions

Domain19 – 152134Galectin 1
Domain187 – 317131Galectin 2
Region249 – 2557Beta-galactoside binding By similarity

Sites

Binding site691Carbohydrate
Binding site791Carbohydrate
Binding site891Carbohydrate
Site591Critical for binding to sialylated and sulfated oligosaccharides

Natural variations

Alternative sequence1831L → LPSNRGGDISKIAPRTVYTK SKDSTVNHTLTCTKIPPMNY VSK in isoform 2.
VSP_003094
Natural variant191F → Y. Ref.3 Ref.4 Ref.8 Ref.10
Corresponds to variant rs2737713 [ dbSNP | Ensembl ].
VAR_012990
Natural variant361R → C. Ref.3 Ref.4 Ref.8 Ref.10
Corresponds to variant rs1041935 [ dbSNP | Ensembl ].
VAR_009710
Natural variant561M → V. Ref.1 Ref.3 Ref.4 Ref.8 Ref.10
Corresponds to variant rs1041937 [ dbSNP | Ensembl ].
VAR_012991
Natural variant1841R → S. Ref.1 Ref.3 Ref.4 Ref.10
Corresponds to variant rs2243525 [ dbSNP | Ensembl ].
VAR_063506

Experimental info

Sequence conflict141N → S in AAL77076. Ref.8
Sequence conflict98 – 1003KRE → QKEK in CAA62904. Ref.2
Sequence conflict1121D → A in CAA62904. Ref.2
Sequence conflict1711S → V in AAB51605. Ref.1
Sequence conflict1991R → G in AAL77076. Ref.8
Sequence conflict2041K → Q in AAB51605. Ref.1
Sequence conflict2251D → H in AAL77076. Ref.8
Sequence conflict2591F → L in AAK16736. Ref.7
Isoform 2:
Sequence conflict2201M → T in AAL77076. Ref.8

Secondary structure

....................................................... 317
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (I) [UniParc].

Last modified March 23, 2010. Version 4.
Checksum: AA13116AC5C0D69A

FASTA31735,808
        10         20         30         40         50         60 
MMLSLNNLQN IIYNPVIPFV GTIPDQLDPG TLIVIRGHVP SDADRFQVDL QNGSSMKPRA 

        70         80         90        100        110        120 
DVAFHFNPRF KRAGCIVCNT LINEKWGREE ITYDTPFKRE KSFEIVIMVL KDKFQVAVNG 

       130        140        150        160        170        180 
KHTLLYGHRI GPEKIDTLGI YGKVNIHSIG FSFSSDLQST QASSLELTEI SRENVPKSGT 

       190        200        210        220        230        240 
PQLRLPFAAR LNTPMGPGRT VVVKGEVNAN AKSFNVDLLA GKSKDIALHL NPRLNIKAFV 

       250        260        270        280        290        300 
RNSFLQESWG EEERNITSFP FSPGMYFEMI IYCDVREFKV AVNGVHSLEY KHRFKELSSI 

       310 
DTLEINGDIH LLEVRSW 

« Hide

Isoform 2 [UniParc].

Checksum: 39BED76B4115A798
Show »

FASTA35940,397

References

« Hide 'large scale' references
[1]"Surface-epitope masking and expression cloning identifies the human prostate carcinoma tumor antigen gene PCTA-1 a member of the galectin gene family."
Su Z.-Z., Lin J., Shen R., Fisher P.E., Goldstein N.I., Fisher P.B.
Proc. Natl. Acad. Sci. U.S.A. 93:7252-7257(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-56 AND SER-184.
Tissue: Prostate.
[2]"Galectin-8: on the road from structure to function."
Hadari Y.R., Eisenstein M., Zakut R., Zick Y.
Trends Glycosci. Glycotechnol. 9:103-112(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Hippocampus.
[3]"Molecular cloning of a beta-galactoside-binding lectin related to galectin-8 and identified in human lung carcinoma."
Brichory F., Bidon N., Desrues B., Bourguet P., Le Pennec J.-P., Dazord L.
Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING, VARIANTS TYR-19; CYS-36; VAL-56 AND SER-184.
Tissue: Lung carcinoma.
[4]"Genomic organization and expression of the human galectin-8 gene."
Maier C., Haeussler J., Roesch K., Moschgath E., Vogel W.
Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TYR-19; CYS-36; VAL-56 AND SER-184.
[5]"Molecular characterization of prostate carcinoma tumor antigen-1, PCTA-1, a human galectin-8 related gene."
Gopalkrishnan R.V., Roberts T., Tuli S., Kang D., Christiansen K.A., Fisher P.B.
Oncogene 19:4405-4416(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[6]"Coca (colorectal carcinoma-derived) galectin-8 variant I full-length cDNA from a human colorectal carcinoma cell line."
Lahm H., Siebert H.-C., Andre S., Hoeflich A., Diehl D., Sordat B., Kaltner H., Wolf E., Gabius H.-J.
Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Colon carcinoma.
[7]"Coca (Colorectal carcinoma-derived) galectin-8 variant II."
Lahm H., Siebert H.-C., Andre S., Hoeflich A., Diehl D., Sordat B., Kaltner H., Wolf E., Gabius H.-J.
Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Colon carcinoma.
[8]"Galectins in murine and human non-Hodgkin's lymphomas."
Moisan S., Mercier J., Demers M., Belanger S.D., Alain T., Kossakowska A.E., Potworowski E.F., St-Pierre Y.
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS TYR-19; CYS-36 AND VAL-56.
[9]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS TYR-19; CYS-36; VAL-56 AND SER-184.
Tissue: Brain and Skin.
[11]"Solution structure of the C-terminal Gal-bind lectin protein from human galectin-8."
RIKEN structural genomics initiative (RSGI)
Submitted (FEB-2008) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 176-317.
[12]"Crystal structure of N-terminal domain of human galectin-8."
RIKEN structural genomics initiative (RSGI)
Submitted (MAY-2008) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (1.92 ANGSTROMS) OF 1-152 IN COMPLEX WITH LACTOSE.
[13]"Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans."
Ideo H., Matsuzaka T., Nonaka T., Seko A., Yamashita K.
J. Biol. Chem. 286:11346-11355(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.33 ANGSTROMS) OF 1-154 ALONE AND IN COMPLEX WITH CARBOHYDRATES, FUNCTION, SUBUNIT.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L78132 mRNA. Translation: AAB51605.1. Different initiation.
X91790 mRNA. Translation: CAA62904.1.
AF074000 mRNA. Translation: AAD45402.1. Different initiation.
AF074001 mRNA. Translation: AAD45403.1. Different initiation.
AF074002 mRNA. Translation: AAD45404.1. Sequence problems.
AF193806, AF193805 Genomic DNA. Translation: AAF19370.1.
AF342815 mRNA. Translation: AAK16735.1.
AF342816 mRNA. Translation: AAK16736.1.
AF468213 mRNA. Translation: AAL77076.1.
AL359921 Genomic DNA. Translation: CAI13773.1.
AL359921 Genomic DNA. Translation: CAI13774.1.
BC015818 mRNA. Translation: AAH15818.1. Different initiation.
BC016486 mRNA. Translation: AAH16486.2. Different initiation.
PIRJC6147.
RefSeqNP_006490.3. NM_006499.4.
NP_963837.1. NM_201543.2.
NP_963838.1. NM_201544.2.
NP_963839.1. NM_201545.2.
UniGeneHs.4082.
Hs.708114.
Hs.735982.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2YRONMR-A176-317[»]
2YV8X-ray1.92A1-152[»]
2YXSX-ray2.13A1-152[»]
3AP4X-ray2.33A/B/C/D1-154[»]
3AP5X-ray1.92A1-154[»]
3AP6X-ray1.58A/B/C/D1-154[»]
3AP7X-ray1.53A1-154[»]
3AP9X-ray1.33A1-154[»]
3APBX-ray1.95A/B1-154[»]
3OJBX-ray3.01A/B/C/D186-315[»]
3VKLX-ray2.55A/B1-317[»]
3VKMX-ray2.98A/B1-317[»]
3VKNX-ray1.98A/B1-153[»]
3VKOX-ray2.08A/B1-153[»]
4FQZX-ray2.80A1-317[»]
4GXLX-ray2.02A186-317[»]
4HANX-ray2.55A/B1-317[»]
ProteinModelPortalO00214.
SMRO00214. Positions 1-317.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110155. 10 interactions.
IntActO00214. 2 interactions.
MINTMINT-1458207.

Chemistry

BindingDBO00214.
ChEMBLCHEMBL5475.

PTM databases

PhosphoSiteO00214.

Proteomic databases

PaxDbO00214.
PRIDEO00214.

Protocols and materials databases

DNASU3964.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000341872; ENSP00000342139; ENSG00000116977. [O00214-1]
ENST00000352231; ENSP00000309576; ENSG00000116977. [O00214-2]
ENST00000366584; ENSP00000355543; ENSG00000116977. [O00214-1]
ENST00000450372; ENSP00000408657; ENSG00000116977. [O00214-2]
ENST00000526589; ENSP00000435460; ENSG00000116977. [O00214-2]
ENST00000526634; ENSP00000437040; ENSG00000116977. [O00214-1]
ENST00000527974; ENSP00000431398; ENSG00000116977. [O00214-2]
GeneID3964.
KEGGhsa:3964.
UCSCuc001hxw.2. human. [O00214-2]
uc001hxz.2. human. [O00214-1]

Organism-specific databases

CTD3964.
GeneCardsGC01P236681.
HGNCHGNC:6569. LGALS8.
HPAHPA030491.
MIM606099. gene.
neXtProtNX_O00214.
PharmGKBPA30346.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG264430.
HOVERGENHBG002412.
KOK06832.
OMAVNIHSVG.
PhylomeDBO00214.
TreeFamTF315551.

Gene expression databases

ArrayExpressO00214.
BgeeO00214.
GenevestigatorO00214.

Family and domain databases

Gene3D2.60.120.200. 2 hits.
InterProIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR001079. Galectin_CRD.
[Graphical view]
PfamPF00337. Gal-bind_lectin. 2 hits.
[Graphical view]
SMARTSM00908. Gal-bind_lectin. 2 hits.
SM00276. GLECT. 2 hits.
[Graphical view]
SUPFAMSSF49899. SSF49899. 2 hits.
PROSITEPS51304. GALECTIN. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLGALS8. human.
EvolutionaryTraceO00214.
GeneWikiGalectin-8.
LGALS8.
GenomeRNAi3964.
NextBio15552.
PROO00214.
SOURCESearch...

Entry information

Entry nameLEG8_HUMAN
AccessionPrimary (citable) accession number: O00214
Secondary accession number(s): O15215 expand/collapse secondary AC list , Q5T3P5, Q5T3Q4, Q8TEV1, Q96B92, Q9BXC8, Q9H584, Q9H585, Q9UEZ6, Q9UP32, Q9UP33, Q9UP34
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 23, 2010
Last modified: April 16, 2014
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM