O00214 (LEG8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Galectin-8 Short name=Gal-8 Alternative name(s): Po66 carbohydrate-binding protein Short name=Po66-CBP Prostate carcinoma tumor antigen 1 Short name=PCTA-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 317 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans. Ref.13 |
| Subunit structure | Homodimer. Ref.13 |
| Subcellular location | Cytoplasm Probable. |
| Tissue specificity | Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy. |
| Domain | Contains two homologous but distinct carbohydrate-binding domains. |
| Sequence similarities | Contains 2 galectin domains. |
| Sequence caution | The sequence AAB51605.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD45402.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD45403.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD45404.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAD45404.1 differs from that shown. Reason: Probable cloning artifact. The sequence AAH15818.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAH16486.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | Lectin |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | T cell costimulation Inferred from electronic annotation. Source: Compara plasma cell differentiationInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell extracellular spaceTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | carbohydrate binding Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O00214-1) Also known as: I; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O00214-2) The sequence of this isoform differs from the canonical sequence as follows: 183-183: L → LPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 317 | 317 | Galectin-8 | PRO_0000076943 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 19 – 152 | 134 | Galectin 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 187 – 317 | 131 | Galectin 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 249 – 255 | 7 | Beta-galactoside binding By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 69 | 1 | Carbohydrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 79 | 1 | Carbohydrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 89 | 1 | Carbohydrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 59 | 1 | Critical for binding to sialylated and sulfated oligosaccharides | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 183 | 1 | L → LPSNRGGDISKIAPRTVYTK SKDSTVNHTLTCTKIPPMNY VSK in isoform 2. | VSP_003094 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 19 | 1 | F → Y. Ref.3 Ref.4 Ref.8 Ref.10 Corresponds to variant rs2737713 [ dbSNP | Ensembl ]. | VAR_012990 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 36 | 1 | R → C. Ref.3 Ref.4 Ref.8 Ref.10 Corresponds to variant rs1041935 [ dbSNP | Ensembl ]. | VAR_009710 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 56 | 1 | M → V. Ref.1 Ref.3 Ref.4 Ref.8 Ref.10 Corresponds to variant rs1041937 [ dbSNP | Ensembl ]. | VAR_012991 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 184 | 1 | R → S. Ref.1 Ref.3 Ref.4 Ref.10 Corresponds to variant rs2243525 [ dbSNP | Ensembl ]. | VAR_063506 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 14 | 1 | N → S in AAL77076. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 98 – 100 | 3 | KRE → QKEK in CAA62904. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 112 | 1 | D → A in CAA62904. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 171 | 1 | S → V in AAB51605. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 199 | 1 | R → G in AAL77076. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 204 | 1 | K → Q in AAB51605. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 225 | 1 | D → H in AAL77076. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 259 | 1 | F → L in AAK16736. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Isoform 2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 220 | 1 | M → T in AAL77076. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4 – 6 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 8 – 14 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 17 – 22 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 32 – 38 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 53 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 56 – 59 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 69 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 71 – 73 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 75 – 82 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 92 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 109 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 111 – 118 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 121 – 127 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 132 – 134 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 143 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 145 – 152 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 185 – 190 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 200 – 207 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 220 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 221 – 224 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 225 – 233 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 234 – 237 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 238 – 244 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 246 – 249 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 256 – 258 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 273 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 275 – 282 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 285 – 291 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 297 – 299 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 302 – 317 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Surface-epitope masking and expression cloning identifies the human prostate carcinoma tumor antigen gene PCTA-1 a member of the galectin gene family." Su Z.-Z., Lin J., Shen R., Fisher P.E., Goldstein N.I., Fisher P.B. Proc. Natl. Acad. Sci. U.S.A. 93:7252-7257(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-56 AND SER-184. Tissue: Prostate. |
| [2] | "Galectin-8: on the road from structure to function." Hadari Y.R., Eisenstein M., Zakut R., Zick Y. Trends Glycosci. Glycotechnol. 9:103-112(1997) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [3] | "Molecular cloning of a beta-galactoside-binding lectin related to galectin-8 and identified in human lung carcinoma." Brichory F., Bidon N., Desrues B., Bourguet P., Le Pennec J.-P., Dazord L. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING, VARIANTS TYR-19; CYS-36; VAL-56 AND SER-184. Tissue: Lung carcinoma. |
| [4] | "Genomic organization and expression of the human galectin-8 gene." Maier C., Haeussler J., Roesch K., Moschgath E., Vogel W. Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TYR-19; CYS-36; VAL-56 AND SER-184. |
| [5] | "Molecular characterization of prostate carcinoma tumor antigen-1, PCTA-1, a human galectin-8 related gene." Gopalkrishnan R.V., Roberts T., Tuli S., Kang D., Christiansen K.A., Fisher P.B. Oncogene 19:4405-4416(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [6] | "Coca (colorectal carcinoma-derived) galectin-8 variant I full-length cDNA from a human colorectal carcinoma cell line." Lahm H., Siebert H.-C., Andre S., Hoeflich A., Diehl D., Sordat B., Kaltner H., Wolf E., Gabius H.-J. Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Colon carcinoma. |
| [7] | "Coca (Colorectal carcinoma-derived) galectin-8 variant II." Lahm H., Siebert H.-C., Andre S., Hoeflich A., Diehl D., Sordat B., Kaltner H., Wolf E., Gabius H.-J. Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Colon carcinoma. |
| [8] | "Galectins in murine and human non-Hodgkin's lymphomas." Moisan S., Mercier J., Demers M., Belanger S.D., Alain T., Kossakowska A.E., Potworowski E.F., St-Pierre Y. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS TYR-19; CYS-36 AND VAL-56. |
| [9] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS TYR-19; CYS-36; VAL-56 AND SER-184. Tissue: Brain and Skin. |
| [11] | "Solution structure of the C-terminal Gal-bind lectin protein from human galectin-8." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 176-317. |
| [12] | "Crystal structure of N-terminal domain of human galectin-8." RIKEN structural genomics initiative (RSGI) Submitted (MAY-2008) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.92 ANGSTROMS) OF 1-152 IN COMPLEX WITH LACTOSE. |
| [13] | "Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans." Ideo H., Matsuzaka T., Nonaka T., Seko A., Yamashita K. J. Biol. Chem. 286:11346-11355(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.33 ANGSTROMS) OF 1-154 ALONE AND IN COMPLEX WITH CARBOHYDRATES, FUNCTION, SUBUNIT. |
| + | Additional computationally mapped references. |
Web resources
| Functional Glycomics Gateway - Glycan Binding Galectin-8 C-terminal CRD |
| Functional Glycomics Gateway - Glycan Binding Galectin-8 long isoform |
| Functional Glycomics Gateway - Glycan Binding Galectin-8 long isoform |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L78132 mRNA. Translation: AAB51605.1. Different initiation. X91790 mRNA. Translation: CAA62904.1. AF074000 mRNA. Translation: AAD45402.1. Different initiation. AF074001 mRNA. Translation: AAD45403.1. Different initiation. AF074002 mRNA. Translation: AAD45404.1. Sequence problems. AF193806, AF193805 Genomic DNA. Translation: AAF19370.1. AF342815 mRNA. Translation: AAK16735.1. AF342816 mRNA. Translation: AAK16736.1. AF468213 mRNA. Translation: AAL77076.1. AL359921 Genomic DNA. Translation: CAI13773.1. AL359921 Genomic DNA. Translation: CAI13774.1. BC015818 mRNA. Translation: AAH15818.1. Different initiation. BC016486 mRNA. Translation: AAH16486.2. Different initiation. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00010844. IPI00165587. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | JC6147. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_006490.3. NM_006499.4. NP_963837.1. NM_201543.2. NP_963838.1. NM_201544.2. NP_963839.1. NM_201545.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.4082. Hs.708114. Hs.735982. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | O00214. Positions 1-317. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O00214. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1458207. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 3964. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000341872; ENSP00000342139; ENSG00000116977. ENST00000352231; ENSP00000309576; ENSG00000116977. ENST00000366584; ENSP00000355543; ENSG00000116977. ENST00000450372; ENSP00000408657; ENSG00000116977. ENST00000526589; ENSP00000435460; ENSG00000116977. ENST00000526634; ENSP00000437040; ENSG00000116977. ENST00000527974; ENSP00000431398; ENSG00000116977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3964. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:3964. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001hxw.2. human. uc001hxz.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 3964. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01P236681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6569. LGALS8. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA030491. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 606099. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30346. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG264430. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG002412. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K06832. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000116977. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.60.120.200. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR013320. ConA-like_subgrp. IPR001079. Galectin_CRD. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00337. Gal-bind_lectin. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00908. Gal-bind_lectin. 2 hits. SM00276. GLECT. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49899. ConA_like_lec_gl. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51304. GALECTIN. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5475. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | LGALS8. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | O00214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 3964. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 15552. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | LEG8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00214 Secondary accession number(s): O15215 Q9UP34 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
