O00192 (ARVC_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Armadillo repeat protein deleted in velo-cardio-facial syndrome | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 962 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in protein-protein interactions at adherens junctions. |
| Subunit structure | Interacts (via the extreme C-terminus) with FRMPD2 (via the PDZ 2 domain). Ref.4 |
| Tissue specificity | Found in all the examined tissues including heart, brain, liver and kidney. Found at low level in lung. |
| Sequence similarities | Belongs to the beta-catenin family. Contains 10 ARM repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Traceable author statement Ref.1. Source: ProtInc multicellular organismal developmentTraceable author statement Ref.1. Source: ProtInc |
| Molecular function | protein binding Inferred from physical interaction Ref.4. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: O00192-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: O00192-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVL → MPAELR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 962 | 962 | Armadillo repeat protein deleted in velo-cardio-facial syndrome | PRO_0000064294 | |||||
Regions | |||||||||
| Repeat | 348 – 387 | 40 | ARM 1 | ||||||
| Repeat | 390 – 429 | 40 | ARM 2 | ||||||
| Repeat | 433 – 467 | 35 | ARM 3 | ||||||
| Repeat | 468 – 508 | 41 | ARM 4 | ||||||
| Repeat | 526 – 565 | 40 | ARM 5 | ||||||
| Repeat | 575 – 622 | 48 | ARM 6 | ||||||
| Repeat | 646 – 686 | 41 | ARM 7 | ||||||
| Repeat | 699 – 738 | 40 | ARM 8 | ||||||
| Repeat | 739 – 781 | 43 | ARM 9 | ||||||
| Repeat | 782 – 826 | 45 | ARM 10 | ||||||
| Coiled coil | 8 – 46 | 39 | Potential | ||||||
| Motif | 607 – 623 | 17 | Nuclear localization signal Potential | ||||||
| Compositional bias | 608 – 611 | 4 | Poly-Arg | ||||||
Amino acid modifications | |||||||||
| Modified residue | 267 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 642 | 1 | Phosphothreonine Ref.3 Ref.5 | ||||||
| Modified residue | 864 | 1 | Phosphoserine Ref.3 | ||||||
| Modified residue | 871 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 872 | 1 | Phosphothreonine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 69 | 69 | MEDCN…QQLVL → MPAELR in isoform Short. | VSP_006739 | |||||
| Natural variant | 175 | 1 | V → A. Corresponds to variant rs2240717 [ dbSNP | Ensembl ]. | VAR_020408 | |||||
| Natural variant | 220 | 1 | P → L. Corresponds to variant rs2073748 [ dbSNP | Ensembl ]. | VAR_033529 | |||||
| Natural variant | 539 | 1 | R → Q. Corresponds to variant rs16982871 [ dbSNP | Ensembl ]. | VAR_053812 | |||||
| Natural variant | 906 | 1 | R → Q. Corresponds to variant rs165815 [ dbSNP | Ensembl ]. | VAR_024692 | |||||
| Natural variant | 909 | 1 | R → Q. Corresponds to variant rs34638476 [ dbSNP | Ensembl ]. | VAR_033531 | |||||
| Natural variant | 909 | 1 | R → W. Corresponds to variant rs34687532 [ dbSNP | Ensembl ]. | VAR_033530 | |||||
| Natural variant | 912 | 1 | R → W. Corresponds to variant rs34445280 [ dbSNP | Ensembl ]. | VAR_033532 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a new human catenin gene family member (ARVCF) from the region deleted in velo-cardio-facial syndrome." Sirotkin H., O'Donnell H., DasGupta R., Halford S., St Jore B., Puech A., Parimoo S., Morrow B., Skoultchi A., Weissman S., Scambler P., Kucherlapati R. Genomics 41:75-83(1997) [PubMed: 9126485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). |
| [2] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-642 AND SER-864, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [4] | "PDZ-domain-directed basolateral targeting of the peripheral membrane protein FRMPD2 in epithelial cells." Stenzel N., Fetzer C.P., Heumann R., Erdmann K.S. J. Cell Sci. 122:3374-3384(2009) [PubMed: 19706687] [Abstract] Cited for: INTERACTION WITH FRMPD2. |
| [5] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-642; SER-871 AND THR-872, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U51269 mRNA. Translation: AAC51202.1. AC005663 Genomic DNA. No translation available. |
| IPI | IPI00010490. IPI00220492. |
| RefSeq | NP_001661.1. NM_001670.2. |
| UniGene | Hs.713616. |
3D structure databases | |
| ProteinModelPortal | O00192. |
| SMR | O00192. Positions 353-852. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O00192. |
PTM databases | |
| PhosphoSite | O00192. |
Proteomic databases | |
| PRIDE | O00192. |
Protocols and materials databases | |
| DNASU | 421. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000263207; ENSP00000263207; ENSG00000099889. ENST00000344269; ENSP00000342042; ENSG00000099889. ENST00000401994; ENSP00000384341; ENSG00000099889. |
| GeneID | 421. |
| KEGG | hsa:421. |
| UCSC | uc002zqz.3. human. |
Organism-specific databases | |
| CTD | 421. |
| GeneCards | GC22M019957. |
| H-InvDB | HIX0016247. |
| HGNC | HGNC:728. ARVCF. |
| HPA | CAB016162. |
| MIM | 602269. gene. |
| neXtProt | NX_O00192. |
| Orphanet | 567. Monosomy 22q11. |
| PharmGKB | PA25018. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG276924. |
| GeneTree | ENSGT00550000074290. |
| HOGENOM | HOG000231862. |
| HOVERGEN | HBG004284. |
| InParanoid | O00192. |
| OMA | ATYIRAT. |
| OrthoDB | EOG4F1X2D. |
| PhylomeDB | O00192. |
Gene expression databases | |
| ArrayExpress | O00192. |
| Bgee | O00192. |
| Genevestigator | O00192. |
| GermOnline | ENSG00000099889. Homo sapiens. |
Family and domain databases | |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 2 hits. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR000225. Armadillo. [Graphical view] |
| Pfam | PF00514. Arm. 3 hits. [Graphical view] |
| SMART | SM00185. ARM. 6 hits. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS50176. ARM_REPEAT. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 1779. |
| SOURCE | Search... |
Entry information
| Entry name | ARVC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00192 Secondary accession number(s): B7WNV2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with