Reviewed,
UniProtKB/Swiss-Prot O00154 (BACH_HUMAN)
Last modified
June 16, 2009.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cytosolic acyl coenzyme A thioester hydrolase EC=3.1.2.2 Alternative name(s): Long chain acyl-CoA thioester hydrolase Acyl-CoA thioesterase 7 CTE-IIa Short name=CTE-II Brain acyl-CoA hydrolase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 380 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA. |
| Catalytic activity | Palmitoyl-CoA + H2O = CoA + palmitate. |
| Subunit structure | Homodimer Probable. |
| Subcellular location | Isoform 1: Mitochondrion. Ref.2 Isoform 5: Mitochondrion. Ref.2 |
| Tissue specificity | |
| Sequence similarities | Contains 2 acyl coenzyme A hydrolase domains. |
| Sequence caution | The sequence AAB61211.1 differs from that shown. Reason: Frameshift at position 371. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Molecular function | Hydrolase Serine esterase |
| Technical term | 3D-structure Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | lipid metabolic process Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | acyl-CoA binding Ref.1 Traceable author statement. Source: ProtInc carboxylesterase activityInferred from electronic annotation. Source: UniProtKB-KW palmitoyl-CoA hydrolase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O00154-1) Also known as: B; HBACHb; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O00154-2) Also known as: A-X; hBACHa-X; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC 287-288: GC → AP 289-380: Missing. | ||||||
| Isoform 3 (identifier: O00154-3) Also known as: A-Xi; hBACHa-Xi; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC 287-380: GCVITISGRM...KRQGHAEPQP → AHVMPAGADH...HLGTHDLHEQ | ||||||
| Isoform 4 (identifier: O00154-4) Also known as: A; hBACHa; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC | ||||||
| Note: Major isoform. | ||||||
| Isoform 5 (identifier: O00154-5) Also known as: C; hBACHc; The sequence of this isoform differs from the canonical sequence as follows: 1-58: MKLLARALRL...PPCGACITGR → MLLLRRSLSLNVLRKEVDRACFGEKAKQ | ||||||
| Isoform 6 (identifier: O00154-6) Also known as: D; hBACHd; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MAFQLS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 380 | 380 | Cytosolic acyl coenzyme A thioester hydrolase | PRO_0000053806 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 68 – 151 | 84 | Acyl coenzyme A hydrolase 1 | |||||||||||||||||||||||||
| Domain | 242 – 319 | 78 | Acyl coenzyme A hydrolase 2 | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 1 – 58 | 58 | MKLLA…CITGR → MLLLRRSLSLNVLRKEVDRA CFGEKAKQ in isoform 5. | VSP_000151 | ||||||||||||||||||||||||
| Alternative sequence | 1 – 57 | 57 | MKLLA…ACITG → MSGPDVETPSAIQIC in isoform 2, isoform 3 and isoform 4. | VSP_000152 | ||||||||||||||||||||||||
| Alternative sequence | 1 – 57 | 57 | MKLLA…ACITG → MAFQLS in isoform 6. | VSP_000153 | ||||||||||||||||||||||||
| Alternative sequence | 287 – 380 | 94 | GCVIT…AEPQP → AHVMPAGADHTAPSSSPSTG TKCSLLRHHHLGTHDLHEQ in isoform 3. | VSP_000154 | ||||||||||||||||||||||||
| Alternative sequence | 287 – 288 | 2 | GC → AP in isoform 2. | VSP_000155 | ||||||||||||||||||||||||
| Alternative sequence | 289 – 380 | 92 | Missing in isoform 2. | VSP_000156 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Sequence conflict | 371 – 372 | 2 | KR → DD in AAB61211. Ref.3 | |||||||||||||||||||||||||
| Sequence conflict | 377 – 378 | 2 | EP → DA in AAB61211. Ref.3 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 223 – 226 | 4 | ||||||||||||||||||||||||||
| Beta strand | 228 – 233 | 6 | ||||||||||||||||||||||||||
| Helix | 236 – 238 | 3 | ||||||||||||||||||||||||||
| Beta strand | 241 – 245 | 5 | ||||||||||||||||||||||||||
| Helix | 247 – 266 | 20 | ||||||||||||||||||||||||||
| Beta strand | 267 – 280 | 14 | ||||||||||||||||||||||||||
| Beta strand | 288 – 299 | 12 | ||||||||||||||||||||||||||
| Beta strand | 301 – 314 | 14 | ||||||||||||||||||||||||||
| Beta strand | 323 – 335 | 13 | ||||||||||||||||||||||||||
| Helix | 352 – 371 | 20 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Purification, molecular cloning, and genomic organization of human brain long-chain acyl-CoA hydrolase." Yamada J., Kurata A., Hirata M., Taniguchi T., Takama H., Furihata T., Shiratori K., Iida N., Takagi-Sakuma M., Watanabe T., Kurosaki K., Endo T., Suga T. J. Biochem. 126:1013-1019(1999) [PubMed: 10578051] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), CHARACTERIZATION. Tissue: Brain. |
| [2] | "Human brain acyl-CoA hydrolase isoforms encoded by a single gene." Yamada J., Kuramochi Y., Takagi M., Watanabe T., Suga T. Biochem. Biophys. Res. Commun. 299:49-56(2002) [PubMed: 12435388] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5 AND 6), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [3] | Hajra A.K., Uhler M.D., Larkins L.K. Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Hippocampus. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Cerebellum. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [8] | Lubec G., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 79-90, MASS SPECTROMETRY. Tissue: Fetal brain. |
| [9] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [10] | "Human acyl-CoA thioesterase 7." Structural genomics consortium (SGC) Submitted (AUG-2007) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 209-378. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| D88894 mRNA. Translation: BAA24350.1. AB074415 mRNA. Translation: BAC20174.1. AB074416 mRNA. Translation: BAC20175.1. AB074417 mRNA. Translation: BAC20176.1. AB074418 mRNA. Translation: BAC20177.1. AB074419 mRNA. Translation: BAC20178.1. U91316 mRNA. Translation: AAB61211.1. Frameshift. BT006888 mRNA. Translation: AAP35534.1. AK289572 mRNA. Translation: BAF82261.1. AL031847, AL031848 Genomic DNA. Translation: CAI19440.1. AL031847, AL031848 Genomic DNA. Translation: CAI19435.1. Different initiation. AL031847, AL031848 Genomic DNA. Translation: CAI19442.1. AL031847, AL031848 Genomic DNA. Translation: CAI19443.1. AL031848, AL031847 Genomic DNA. Translation: CAI19774.1. Different initiation. AL031848, AL031847 Genomic DNA. Translation: CAI19777.1. AL031848, AL031847 Genomic DNA. Translation: CAI19778.1. AL031848, AL031847 Genomic DNA. Translation: CAI19779.1. BC017365 mRNA. Translation: AAH17365.2. Different initiation. | |||||||||||||
| IPI | IPI00010415. IPI00219451. IPI00219452. IPI00395748. IPI00746126. IPI00883762. | ||||||||||||
| PIR | JC7161. | ||||||||||||
| RefSeq | NP_009205.3. NP_863654.1. NP_863655.1. NP_863656.1. | ||||||||||||
| UniGene | Hs.126137 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O00154. 1 interaction. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O00154. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000097021. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 11332. | ||||||||||||
| KEGG | hsa:11332. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC01M006259. | ||||||||||||
| H-InvDB | HIX0021757. | ||||||||||||
| HGNC | HGNC:24157. ACOT7. | ||||||||||||
| MIM | 602587. gene. | ||||||||||||
| PharmGKB | PA142672655. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | O00154. | ||||||||||||
| OMA | O00154. AALWYVP. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.2.2. 247. 3.1.2.20. 247. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O00154. | ||||||||||||
| Bgee | O00154. | ||||||||||||
| GermOnline | ENSG00000097021. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR006683. Thioestr_supf. [Graphical view] | ||||||||||||
| Pfam | PF03061. 4HBT. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 43047. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BACH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00154 Secondary accession number(s): A8K0K7 Q9Y540 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


