O00154 (BACH_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic acyl coenzyme A thioester hydrolase EC=3.1.2.2 Alternative name(s): Acyl-CoA thioesterase 7 Brain acyl-CoA hydrolase Short name=BACH CTE-IIa Short name=CTE-II Long chain acyl-CoA thioester hydrolase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 380 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA. |
| Catalytic activity | Palmitoyl-CoA + H2O = CoA + palmitate. |
| Subunit structure | Homohexamer By similarity. |
| Subcellular location | Isoform 1: Mitochondrion Ref.2. Isoform 5: Mitochondrion Ref.2. |
| Tissue specificity | |
| Domain | Both hydrolase domains are required for efficient activity By similarity. |
| Sequence similarities | Contains 2 acyl coenzyme A hydrolase domains. |
| Sequence caution | The sequence AAB61211.1 differs from that shown. Reason: Frameshift at position 371. The sequence AAH17365.2 differs from that shown. Reason: Erroneous initiation. The sequence CAI19435.1 differs from that shown. Reason: Erroneous initiation. The sequence CAI19774.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Molecular function | Hydrolase Serine esterase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | carboxylesterase activity Inferred from electronic annotation. Source: UniProtKB-KW fatty-acyl-CoA bindingTraceable author statement. Source: ProtInc palmitoyl-CoA hydrolase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O00154-1) Also known as: B; HBACHb; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O00154-2) Also known as: A-X; hBACHa-X; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC 287-288: GC → AP 289-380: Missing. | ||||||
| Isoform 3 (identifier: O00154-3) Also known as: A-Xi; hBACHa-Xi; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC 287-380: GCVITISGRM...KRQGHAEPQP → AHVMPAGADH...HLGTHDLHEQ | ||||||
| Isoform 4 (identifier: O00154-4) Also known as: A; hBACHa; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC | ||||||
| Note: Major isoform. | ||||||
| Isoform 5 (identifier: O00154-5) Also known as: C; hBACHc; The sequence of this isoform differs from the canonical sequence as follows: 1-58: MKLLARALRL...PPCGACITGR → MLLLRRSLSLNVLRKEVDRACFGEKAKQ | ||||||
| Isoform 6 (identifier: O00154-6) Also known as: D; hBACHd; The sequence of this isoform differs from the canonical sequence as follows: 1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MAFQLS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 380 | 380 | Cytosolic acyl coenzyme A thioester hydrolase | PRO_0000053806 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 56 – 151 | 96 | Acyl coenzyme A hydrolase 1 | |||||||||||||||||||||||||
| Domain | 242 – 319 | 78 | Acyl coenzyme A hydrolase 2 | |||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||
| Active site | 66 | 1 | By similarity | |||||||||||||||||||||||||
| Active site | 255 | 1 | By similarity | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 78 | 1 | N6-acetyllysine Ref.10 | |||||||||||||||||||||||||
| Modified residue | 168 | 1 | N6-acetyllysine Ref.10 | |||||||||||||||||||||||||
| Modified residue | 198 | 1 | N6-acetyllysine Ref.10 | |||||||||||||||||||||||||
| Modified residue | 283 | 1 | N6-acetyllysine Ref.10 | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 1 – 58 | 58 | MKLLA…CITGR → MLLLRRSLSLNVLRKEVDRA CFGEKAKQ in isoform 5. | VSP_000151 | ||||||||||||||||||||||||
| Alternative sequence | 1 – 57 | 57 | MKLLA…ACITG → MSGPDVETPSAIQIC in isoform 2, isoform 3 and isoform 4. | VSP_000152 | ||||||||||||||||||||||||
| Alternative sequence | 1 – 57 | 57 | MKLLA…ACITG → MAFQLS in isoform 6. | VSP_000153 | ||||||||||||||||||||||||
| Alternative sequence | 287 – 380 | 94 | GCVIT…AEPQP → AHVMPAGADHTAPSSSPSTG TKCSLLRHHHLGTHDLHEQ in isoform 3. | VSP_000154 | ||||||||||||||||||||||||
| Alternative sequence | 287 – 288 | 2 | GC → AP in isoform 2. | VSP_000155 | ||||||||||||||||||||||||
| Alternative sequence | 289 – 380 | 92 | Missing in isoform 2. | VSP_000156 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Sequence conflict | 371 – 372 | 2 | KR → DD in AAB61211. Ref.3 | |||||||||||||||||||||||||
| Sequence conflict | 377 – 378 | 2 | EP → DA in AAB61211. Ref.3 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 223 – 226 | 4 | ||||||||||||||||||||||||||
| Beta strand | 228 – 233 | 6 | ||||||||||||||||||||||||||
| Helix | 236 – 238 | 3 | ||||||||||||||||||||||||||
| Beta strand | 241 – 245 | 5 | ||||||||||||||||||||||||||
| Helix | 247 – 266 | 20 | ||||||||||||||||||||||||||
| Beta strand | 267 – 280 | 14 | ||||||||||||||||||||||||||
| Beta strand | 288 – 299 | 12 | ||||||||||||||||||||||||||
| Beta strand | 301 – 314 | 14 | ||||||||||||||||||||||||||
| Beta strand | 323 – 335 | 13 | ||||||||||||||||||||||||||
| Helix | 352 – 371 | 20 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Purification, molecular cloning, and genomic organization of human brain long-chain acyl-CoA hydrolase." Yamada J., Kurata A., Hirata M., Taniguchi T., Takama H., Furihata T., Shiratori K., Iida N., Takagi-Sakuma M., Watanabe T., Kurosaki K., Endo T., Suga T. J. Biochem. 126:1013-1019(1999) [PubMed: 10578051] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), CHARACTERIZATION. Tissue: Brain. |
| [2] | "Human brain acyl-CoA hydrolase isoforms encoded by a single gene." Yamada J., Kuramochi Y., Takagi M., Watanabe T., Suga T. Biochem. Biophys. Res. Commun. 299:49-56(2002) [PubMed: 12435388] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5 AND 6), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [3] | Hajra A.K., Uhler M.D., Larkins L.K. Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Hippocampus. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4; 5 AND 6). Tissue: Cerebellum, Colon, Placenta and Subthalamic nucleus. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [9] | Lubec G., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 79-90, MASS SPECTROMETRY. Tissue: Fetal brain. |
| [10] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-78; LYS-168; LYS-198 AND LYS-283, MASS SPECTROMETRY. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Human acyl-CoA thioesterase 7." Structural genomics consortium (SGC) Submitted (AUG-2007) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 209-378. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D88894 mRNA. Translation: BAA24350.1. AB074415 mRNA. Translation: BAC20174.1. AB074416 mRNA. Translation: BAC20175.1. AB074417 mRNA. Translation: BAC20176.1. AB074418 mRNA. Translation: BAC20177.1. AB074419 mRNA. Translation: BAC20178.1. U91316 mRNA. Translation: AAB61211.1. Frameshift. BT006888 mRNA. Translation: AAP35534.1. AK289572 mRNA. Translation: BAF82261.1. AK290097 mRNA. Translation: BAF82786.1. AK291583 mRNA. Translation: BAF84272.1. AK292202 mRNA. Translation: BAF84891.1. AL031847, AL031848 Genomic DNA. Translation: CAI19440.1. AL031847, AL031848 Genomic DNA. Translation: CAI19435.1. Different initiation. AL031847, AL031848 Genomic DNA. Translation: CAI19442.1. AL031847, AL031848 Genomic DNA. Translation: CAI19443.1. AL031848, AL031847 Genomic DNA. Translation: CAI19774.1. Different initiation. AL031848, AL031847 Genomic DNA. Translation: CAI19777.1. AL031848, AL031847 Genomic DNA. Translation: CAI19778.1. AL031848, AL031847 Genomic DNA. Translation: CAI19779.1. CH471130 Genomic DNA. Translation: EAW71528.1. CH471130 Genomic DNA. Translation: EAW71529.1. CH471130 Genomic DNA. Translation: EAW71530.1. BC017365 mRNA. Translation: AAH17365.2. Different initiation. | ||||||||||||
| IPI | IPI00010415. IPI00219451. IPI00219452. IPI00395748. IPI00746126. IPI00883762. | ||||||||||||
| PIR | JC7161. | ||||||||||||
| RefSeq | NP_009205.3. NM_007274.3. NP_863654.1. NM_181864.2. NP_863655.1. NM_181865.2. NP_863656.1. NM_181866.2. | ||||||||||||
| UniGene | Hs.126137. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O00154. | ||||||||||||
| SMR | O00154. Positions 51-373. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O00154. 2 interactions. | ||||||||||||
| MINT | MINT-2869715. | ||||||||||||
| STRING | O00154. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O00154. | ||||||||||||
2D gel databases | |||||||||||||
| UCD-2DPAGE | O00154. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O00154. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000377855; ENSP00000367086; ENSG00000097021. | ||||||||||||
| GeneID | 11332. | ||||||||||||
| KEGG | hsa:11332. | ||||||||||||
| UCSC | uc001amq.1. human. uc001amr.1. human. uc001ams.1. human. uc001amt.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 11332. | ||||||||||||
| GeneCards | GC01M006324. | ||||||||||||
| HGNC | HGNC:24157. ACOT7. | ||||||||||||
| HPA | HPA025735. HPA025762. | ||||||||||||
| MIM | 602587. gene. | ||||||||||||
| neXtProt | NX_O00154. | ||||||||||||
| PharmGKB | PA142672655. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG17259. | ||||||||||||
| GeneTree | ENSGT00390000000934. | ||||||||||||
| HOVERGEN | HBG036928. | ||||||||||||
| InParanoid | O00154. | ||||||||||||
| OrthoDB | EOG4JWVF5. | ||||||||||||
| PhylomeDB | O00154. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.2.2. 2681. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O00154. | ||||||||||||
| Bgee | O00154. | ||||||||||||
| Genevestigator | O00154. | ||||||||||||
| GermOnline | ENSG00000097021. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR006683. Thioestr_supf. [Graphical view] | ||||||||||||
| KO | K01068. | ||||||||||||
| Pfam | PF03061. 4HBT. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 43047. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BACH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00154 Secondary accession number(s): A8K0K7 Q9Y540 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with