Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic acyl coenzyme A thioester hydrolase

Gene

ACOT7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA.

Catalytic activityi

Palmitoyl-CoA + H2O = CoA + palmitate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei66By similarity1
Active sitei255By similarity1

GO - Molecular functioni

  • acyl-CoA hydrolase activity Source: Reactome
  • carboxylic ester hydrolase activity Source: UniProtKB-KW
  • fatty-acyl-CoA binding Source: BHF-UCL
  • long-chain fatty acyl-CoA binding Source: BHF-UCL
  • palmitoyl-CoA hydrolase activity Source: BHF-UCL
  • protein homodimerization activity Source: BHF-UCL

GO - Biological processi

  • coenzyme A biosynthetic process Source: BHF-UCL
  • long-chain fatty-acyl-CoA biosynthetic process Source: Reactome
  • long-chain fatty-acyl-CoA catabolic process Source: BHF-UCL
  • medium-chain fatty acid biosynthetic process Source: BHF-UCL
  • medium-chain fatty-acyl-CoA catabolic process Source: BHF-UCL
  • palmitic acid biosynthetic process Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Serine esterase

Enzyme and pathway databases

BioCyciZFISH:HS01875-MONOMER.
BRENDAi3.1.2.2. 2681.
3.1.2.20. 2681.
ReactomeiR-HSA-75105. Fatty Acyl-CoA Biosynthesis.
SABIO-RKO00154.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic acyl coenzyme A thioester hydrolase (EC:3.1.2.2)
Alternative name(s):
Acyl-CoA thioesterase 7
Brain acyl-CoA hydrolase
Short name:
BACH
CTE-IIa
Short name:
CTE-II
Long chain acyl-CoA thioester hydrolase
Gene namesi
Name:ACOT7
Synonyms:BACH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24157. ACOT7.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: BHF-UCL
  • extracellular exosome Source: UniProtKB
  • mitochondrion Source: UniProtKB-SubCell
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi11332.
OpenTargetsiENSG00000097021.
PharmGKBiPA142672655.

Polymorphism and mutation databases

BioMutaiACOT7.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538061 – 380Cytosolic acyl coenzyme A thioester hydrolaseAdd BLAST380

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei168N6-acetyllysineCombined sources1
Modified residuei198N6-acetyllysineCombined sources1
Modified residuei283N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO00154.
MaxQBiO00154.
PaxDbiO00154.
PeptideAtlasiO00154.
PRIDEiO00154.
TopDownProteomicsiO00154-1. [O00154-1]

2D gel databases

UCD-2DPAGEO00154.

PTM databases

iPTMnetiO00154.
PhosphoSitePlusiO00154.
SwissPalmiO00154.

Expressioni

Tissue specificityi

Isoform 4 is expressed exclusively in brain.1 Publication

Gene expression databases

BgeeiENSG00000097021.
ExpressionAtlasiO00154. baseline and differential.
GenevisibleiO00154. HS.

Organism-specific databases

HPAiHPA025735.
HPA025762.

Interactioni

Subunit structurei

Homohexamer.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
CAMK2BQ135543EBI-948905,EBI-1058722
HEL-S-101V9HW273EBI-948905,EBI-10178933
MAGEA6P433603EBI-948905,EBI-1045155
THAP1Q9NVV93EBI-948905,EBI-741515
UBQLN1Q9UMX03EBI-948905,EBI-741480
UBQLN1Q9UMX0-23EBI-948905,EBI-10173939

GO - Molecular functioni

  • protein homodimerization activity Source: BHF-UCL

Protein-protein interaction databases

BioGridi116460. 31 interactors.
IntActiO00154. 20 interactors.
MINTiMINT-2869715.
STRINGi9606.ENSP00000367086.

Structurei

Secondary structure

1380
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi223 – 226Combined sources4
Beta strandi228 – 233Combined sources6
Helixi236 – 238Combined sources3
Beta strandi241 – 245Combined sources5
Helixi247 – 266Combined sources20
Beta strandi267 – 280Combined sources14
Beta strandi288 – 299Combined sources12
Beta strandi301 – 314Combined sources14
Beta strandi323 – 335Combined sources13
Helixi352 – 371Combined sources20

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QQ2X-ray2.80A/B/C/D/E/F/G/H/I/J/K/L209-378[»]
ProteinModelPortaliO00154.
SMRiO00154.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00154.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 168HotDog ACOT-type 1PROSITE-ProRule annotationAdd BLAST119
Domaini224 – 338HotDog ACOT-type 2PROSITE-ProRule annotationAdd BLAST115

Domaini

Both HotDog ACOT-type hydrolase domains are required for efficient activity.By similarity

Sequence similaritiesi

Contains 2 HotDog ACOT-type domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2763. Eukaryota.
COG1607. LUCA.
GeneTreeiENSGT00760000119297.
HOGENOMiHOG000007663.
HOVERGENiHBG036928.
InParanoidiO00154.
KOiK17360.
OMAiMFIGEVA.
OrthoDBiEOG091G0CG4.
PhylomeDBiO00154.
TreeFamiTF329579.

Family and domain databases

Gene3Di3.10.129.10. 2 hits.
InterProiIPR033120. HOTDOG_ACOT.
IPR029069. HotDog_dom.
IPR006683. Thioestr_dom.
[Graphical view]
PfamiPF03061. 4HBT. 2 hits.
[Graphical view]
SUPFAMiSSF54637. SSF54637. 2 hits.
PROSITEiPS51770. HOTDOG_ACOT. 2 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00154-1) [UniParc]FASTAAdd to basket
Also known as: B, HBACHb

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLLARALRL CEFGRQASSR RLVAGQGCVG PRRGCCAPVQ VVGPRADLPP
60 70 80 90 100
CGACITGRIM RPDDANVAGN VHGGTILKMI EEAGAIISTR HCNSQNGERC
110 120 130 140 150
VAALARVERT DFLSPMCIGE VAHVSAEITY TSKHSVEVQV NVMSENILTG
160 170 180 190 200
AKKLTNKATL WYVPLSLKNV DKVLEVPPVV YSRQEQEEEG RKRYEAQKLE
210 220 230 240 250
RMETKWRNGD IVQPVLNPEP NTVSYSQSSL IHLVGPSDCT LHGFVHGGVT
260 270 280 290 300
MKLMDEVAGI VAARHCKTNI VTASVDAINF HDKIRKGCVI TISGRMTFTS
310 320 330 340 350
NKSMEIEVLV DADPVVDSSQ KRYRAASAFF TYVSLSQEGR SLPVPQLVPE
360 370 380
TEDEKKRFEE GKGRYLQMKA KRQGHAEPQP
Length:380
Mass (Da):41,796
Last modified:February 12, 2003 - v3
Checksum:iBDD75D62A60095BC
GO
Isoform 2 (identifier: O00154-2) [UniParc]FASTAAdd to basket
Also known as: A-X, hBACHa-X

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC
     287-288: GC → AP
     289-380: Missing.

Show »
Length:246
Mass (Da):27,041
Checksum:i4CDCAD44CE427904
GO
Isoform 3 (identifier: O00154-3) [UniParc]FASTAAdd to basket
Also known as: A-Xi, hBACHa-Xi

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC
     287-380: GCVITISGRM...KRQGHAEPQP → AHVMPAGADH...HLGTHDLHEQ

Show »
Length:283
Mass (Da):30,977
Checksum:iC21B4544638BA031
GO
Isoform 4 (identifier: O00154-4) [UniParc]FASTAAdd to basket
Also known as: A, hBACHa

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MSGPDVETPSAIQIC

Note: Major isoform.
Show »
Length:338
Mass (Da):37,420
Checksum:i95E4CB4B0A7AF34C
GO
Isoform 5 (identifier: O00154-5) [UniParc]FASTAAdd to basket
Also known as: C, hBACHc

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: MKLLARALRL...PPCGACITGR → MLLLRRSLSLNVLRKEVDRACFGEKAKQ

Show »
Length:350
Mass (Da):38,991
Checksum:iD8FA42B2583051BA
GO
Isoform 6 (identifier: O00154-6) [UniParc]FASTAAdd to basket
Also known as: D, hBACHd

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITG → MAFQLS

Show »
Length:329
Mass (Da):36,568
Checksum:iECEB0F657ADF6E25
GO
Isoform 7 (identifier: O00154-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MKLLARALRL...LPPCGACITG → MARPGLIHSA...VETPSAIQIC

Show »
Length:370
Mass (Da):40,455
Checksum:i28F0088FFF813417
GO

Sequence cautioni

The sequence AAB61211 differs from that shown. Reason: Frameshift at position 371.Curated
The sequence AAH17365 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI19435 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI19774 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti82E → G in BAG51874 (PubMed:14702039).Curated1
Sequence conflicti371 – 372KR → DD in AAB61211 (Ref. 3) Curated2
Sequence conflicti377 – 378EP → DA in AAB61211 (Ref. 3) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0001511 – 58MKLLA…CITGR → MLLLRRSLSLNVLRKEVDRA CFGEKAKQ in isoform 5. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_0001521 – 57MKLLA…ACITG → MSGPDVETPSAIQIC in isoform 2, isoform 3 and isoform 4. 6 PublicationsAdd BLAST57
Alternative sequenceiVSP_0001531 – 57MKLLA…ACITG → MAFQLS in isoform 6. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_0470941 – 57MKLLA…ACITG → MARPGLIHSAPGLPDTCALL QPPAASAAAAPSMSGPDVET PSAIQIC in isoform 7. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_000154287 – 380GCVIT…AEPQP → AHVMPAGADHTAPSSSPSTG TKCSLLRHHHLGTHDLHEQ in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_000155287 – 288GC → AP in isoform 2. 1 Publication2
Alternative sequenceiVSP_000156289 – 380Missing in isoform 2. 1 PublicationAdd BLAST92

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88894 mRNA. Translation: BAA24350.1.
AB074415 mRNA. Translation: BAC20174.1.
AB074416 mRNA. Translation: BAC20175.1.
AB074417 mRNA. Translation: BAC20176.1.
AB074418 mRNA. Translation: BAC20177.1.
AB074419 mRNA. Translation: BAC20178.1.
U91316 mRNA. Translation: AAB61211.1. Frameshift.
BT006888 mRNA. Translation: AAP35534.1.
AK289572 mRNA. Translation: BAF82261.1.
AK290097 mRNA. Translation: BAF82786.1.
AK291583 mRNA. Translation: BAF84272.1.
AK292202 mRNA. Translation: BAF84891.1.
AK057168 mRNA. Translation: BAG51874.1.
AL031847, AL031848 Genomic DNA. Translation: CAI19440.1.
AL031847, AL031848 Genomic DNA. Translation: CAI19435.1. Different initiation.
AL031847, AL031848 Genomic DNA. Translation: CAI19442.1.
AL031847, AL031848 Genomic DNA. Translation: CAI19443.1.
AL031848, AL031847 Genomic DNA. Translation: CAI19774.1. Different initiation.
AL031848, AL031847 Genomic DNA. Translation: CAI19777.1.
AL031848, AL031847 Genomic DNA. Translation: CAI19778.1.
AL031848, AL031847 Genomic DNA. Translation: CAI19779.1.
CH471130 Genomic DNA. Translation: EAW71528.1.
CH471130 Genomic DNA. Translation: EAW71529.1.
CH471130 Genomic DNA. Translation: EAW71530.1.
BC017365 mRNA. Translation: AAH17365.2. Different initiation.
CCDSiCCDS30573.1. [O00154-7]
CCDS65.1. [O00154-1]
CCDS66.1. [O00154-5]
CCDS67.1. [O00154-6]
PIRiJC7161.
RefSeqiNP_009205.3. NM_007274.3. [O00154-7]
NP_863654.1. NM_181864.2. [O00154-1]
NP_863655.1. NM_181865.2. [O00154-5]
NP_863656.1. NM_181866.2. [O00154-6]
UniGeneiHs.126137.

Genome annotation databases

EnsembliENST00000361521; ENSP00000354615; ENSG00000097021. [O00154-7]
ENST00000377842; ENSP00000367073; ENSG00000097021. [O00154-6]
ENST00000377845; ENSP00000367076; ENSG00000097021. [O00154-5]
ENST00000377855; ENSP00000367086; ENSG00000097021. [O00154-1]
ENST00000377860; ENSP00000367091; ENSG00000097021. [O00154-3]
ENST00000418124; ENSP00000402532; ENSG00000097021. [O00154-2]
ENST00000545482; ENSP00000439218; ENSG00000097021. [O00154-7]
ENST00000608083; ENSP00000476610; ENSG00000097021. [O00154-4]
GeneIDi11332.
KEGGihsa:11332.
UCSCiuc001amq.4. human. [O00154-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88894 mRNA. Translation: BAA24350.1.
AB074415 mRNA. Translation: BAC20174.1.
AB074416 mRNA. Translation: BAC20175.1.
AB074417 mRNA. Translation: BAC20176.1.
AB074418 mRNA. Translation: BAC20177.1.
AB074419 mRNA. Translation: BAC20178.1.
U91316 mRNA. Translation: AAB61211.1. Frameshift.
BT006888 mRNA. Translation: AAP35534.1.
AK289572 mRNA. Translation: BAF82261.1.
AK290097 mRNA. Translation: BAF82786.1.
AK291583 mRNA. Translation: BAF84272.1.
AK292202 mRNA. Translation: BAF84891.1.
AK057168 mRNA. Translation: BAG51874.1.
AL031847, AL031848 Genomic DNA. Translation: CAI19440.1.
AL031847, AL031848 Genomic DNA. Translation: CAI19435.1. Different initiation.
AL031847, AL031848 Genomic DNA. Translation: CAI19442.1.
AL031847, AL031848 Genomic DNA. Translation: CAI19443.1.
AL031848, AL031847 Genomic DNA. Translation: CAI19774.1. Different initiation.
AL031848, AL031847 Genomic DNA. Translation: CAI19777.1.
AL031848, AL031847 Genomic DNA. Translation: CAI19778.1.
AL031848, AL031847 Genomic DNA. Translation: CAI19779.1.
CH471130 Genomic DNA. Translation: EAW71528.1.
CH471130 Genomic DNA. Translation: EAW71529.1.
CH471130 Genomic DNA. Translation: EAW71530.1.
BC017365 mRNA. Translation: AAH17365.2. Different initiation.
CCDSiCCDS30573.1. [O00154-7]
CCDS65.1. [O00154-1]
CCDS66.1. [O00154-5]
CCDS67.1. [O00154-6]
PIRiJC7161.
RefSeqiNP_009205.3. NM_007274.3. [O00154-7]
NP_863654.1. NM_181864.2. [O00154-1]
NP_863655.1. NM_181865.2. [O00154-5]
NP_863656.1. NM_181866.2. [O00154-6]
UniGeneiHs.126137.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QQ2X-ray2.80A/B/C/D/E/F/G/H/I/J/K/L209-378[»]
ProteinModelPortaliO00154.
SMRiO00154.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116460. 31 interactors.
IntActiO00154. 20 interactors.
MINTiMINT-2869715.
STRINGi9606.ENSP00000367086.

PTM databases

iPTMnetiO00154.
PhosphoSitePlusiO00154.
SwissPalmiO00154.

Polymorphism and mutation databases

BioMutaiACOT7.

2D gel databases

UCD-2DPAGEO00154.

Proteomic databases

EPDiO00154.
MaxQBiO00154.
PaxDbiO00154.
PeptideAtlasiO00154.
PRIDEiO00154.
TopDownProteomicsiO00154-1. [O00154-1]

Protocols and materials databases

DNASUi11332.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361521; ENSP00000354615; ENSG00000097021. [O00154-7]
ENST00000377842; ENSP00000367073; ENSG00000097021. [O00154-6]
ENST00000377845; ENSP00000367076; ENSG00000097021. [O00154-5]
ENST00000377855; ENSP00000367086; ENSG00000097021. [O00154-1]
ENST00000377860; ENSP00000367091; ENSG00000097021. [O00154-3]
ENST00000418124; ENSP00000402532; ENSG00000097021. [O00154-2]
ENST00000545482; ENSP00000439218; ENSG00000097021. [O00154-7]
ENST00000608083; ENSP00000476610; ENSG00000097021. [O00154-4]
GeneIDi11332.
KEGGihsa:11332.
UCSCiuc001amq.4. human. [O00154-1]

Organism-specific databases

CTDi11332.
DisGeNETi11332.
GeneCardsiACOT7.
HGNCiHGNC:24157. ACOT7.
HPAiHPA025735.
HPA025762.
MIMi602587. gene.
neXtProtiNX_O00154.
OpenTargetsiENSG00000097021.
PharmGKBiPA142672655.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2763. Eukaryota.
COG1607. LUCA.
GeneTreeiENSGT00760000119297.
HOGENOMiHOG000007663.
HOVERGENiHBG036928.
InParanoidiO00154.
KOiK17360.
OMAiMFIGEVA.
OrthoDBiEOG091G0CG4.
PhylomeDBiO00154.
TreeFamiTF329579.

Enzyme and pathway databases

BioCyciZFISH:HS01875-MONOMER.
BRENDAi3.1.2.2. 2681.
3.1.2.20. 2681.
ReactomeiR-HSA-75105. Fatty Acyl-CoA Biosynthesis.
SABIO-RKO00154.

Miscellaneous databases

ChiTaRSiACOT7. human.
EvolutionaryTraceiO00154.
GeneWikiiACOT7.
GenomeRNAii11332.
PROiO00154.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000097021.
ExpressionAtlasiO00154. baseline and differential.
GenevisibleiO00154. HS.

Family and domain databases

Gene3Di3.10.129.10. 2 hits.
InterProiIPR033120. HOTDOG_ACOT.
IPR029069. HotDog_dom.
IPR006683. Thioestr_dom.
[Graphical view]
PfamiPF03061. 4HBT. 2 hits.
[Graphical view]
SUPFAMiSSF54637. SSF54637. 2 hits.
PROSITEiPS51770. HOTDOG_ACOT. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBACH_HUMAN
AccessioniPrimary (citable) accession number: O00154
Secondary accession number(s): A8K0K7
, A8K232, A8K6B8, A8K837, B3KQ12, O43703, Q53Y78, Q5JYL2, Q5JYL3, Q5JYL4, Q5JYL5, Q5JYL6, Q5TGR4, Q9UJM9, Q9Y539, Q9Y540
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 12, 2003
Last modified: November 30, 2016
This is version 160 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.