ID KITM_HUMAN Reviewed; 265 AA. AC O00142; O15238; DT 01-NOV-1997, integrated into UniProtKB/Swiss-Prot. DT 28-JUL-2009, sequence version 4. DT 24-NOV-2009, entry version 88. DE RecName: Full=Thymidine kinase 2, mitochondrial; DE EC=2.7.1.21; DE AltName: Full=Mt-TK; DE Flags: Precursor; GN Name=TK2; OS Homo sapiens (Human). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; OC Catarrhini; Hominidae; Homo. OX NCBI_TaxID=9606; RN [1] RP NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). RC TISSUE=Liver; RX MEDLINE=97236800; PubMed=9079672; DOI=10.1074/jbc.272.13.8454; RA Johansson M., Karlsson A.; RT "Cloning of the cDNA and chromosome localization of the gene for human RT thymidine kinase 2."; RL J. Biol. Chem. 272:8454-8458(1997). RN [2] RP NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), PROTEIN SEQUENCE OF 34-61 RP (ISOFORM LONG), AND CHARACTERIZATION. RC TISSUE=Brain; RX MEDLINE=99142705; PubMed=9989599; DOI=10.1016/S0014-5793(98)01711-6; RA Wang L., Munch-Petersen B., Herrstroem Sjoeberg A., Hellman U., RA Bergman T., Joernvall H., Eriksson S.; RT "Human thymidine kinase 2: molecular cloning and characterisation of RT the enzyme activity with antiviral and cytostatic nucleoside RT substrates."; RL FEBS Lett. 443:170-174(1999). RN [3] RP SEQUENCE REVISION. RA Wang L.; RL Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. RN [4] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RX PubMed=15616553; DOI=10.1038/nature03187; RA Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., RA Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., RA Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J., RA Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., RA Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., RA Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., RA Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., RA Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., RA Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., RA Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., RA Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., RA Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., RA Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., RA Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., RA Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., RA Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., RA Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., RA Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., RA Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., RA Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., RA Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., RA Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., RA Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., RA Rubin E.M., Pennacchio L.A.; RT "The sequence and analysis of duplication-rich human chromosome 16."; RL Nature 432:988-994(2004). RN [5] RP VARIANTS MDS ASN-121 AND ASN-212. RX MEDLINE=21547527; PubMed=11687801; DOI=10.1038/ng751; RA Saada A., Shaag A., Mandel H., Nevo Y., Eriksson S., Elpeleg O.; RT "Mutant mitochondrial thymidine kinase in mitochondrial DNA depletion RT myopathy."; RL Nat. Genet. 29:342-344(2001). RN [6] RP VARIANTS MDS MET-53; MET-108 AND ASN-121. RX MEDLINE=22278962; PubMed=12391347; RA Mancuso M., Salviati L., Sacconi S., Otaegui D., Camano P., Marina A., RA Bacman S., Moraes C.T., Carlo J.R., Garcia M., Garcia-Alvarez M., RA Monzon L., Naini A.B., Hirano M., Bonilla E., Taratuto A.L., RA DiMauro S., Vu T.H.; RT "Mitochondrial DNA depletion: mutations in thymidine kinase gene with RT myopathy and SMA."; RL Neurology 59:1197-1202(2002). RN [7] RP VARIANTS MDS MET-108 AND LYS-192, AND CHARACTERIZATION OF VARIANTS MDS RP MET-108 AND LYS-192. RX PubMed=15639197; DOI=10.1016/j.ymgme.2004.09.005; RA Wang L., Limongelli A., Vila M.R., Carrara F., Zeviani M., RA Eriksson S.; RT "Molecular insight into mitochondrial DNA depletion syndrome in two RT patients with novel mutations in the deoxyguanosine kinase and RT thymidine kinase 2 genes."; RL Mol. Genet. Metab. 84:75-82(2005). RN [8] RP VARIANTS MDS MET-64 AND TRP-183. RX PubMed=15907288; DOI=10.1016/j.nmd.2005.03.010; RA Tulinius M., Moslemi A.-R., Darin N., Holme E., Oldfors A.; RT "Novel mutations in the thymidine kinase 2 gene (TK2) associated with RT fatal mitochondrial myopathy and mitochondrial DNA depletion."; RL Neuromuscul. Disord. 15:412-415(2005). CC -!- FUNCTION: Deoxyribonucleoside kinase that phosphorylates CC thymidine, deoxycytidine, and deoxyuridine. Also phosphorylates CC anti-viral and anti-cancer nucleoside analogs. CC -!- CATALYTIC ACTIVITY: ATP + thymidine = ADP + thymidine 5'- CC phosphate. CC -!- SUBUNIT: Monomer. CC -!- SUBCELLULAR LOCATION: Mitochondrion. CC -!- ALTERNATIVE PRODUCTS: CC Event=Alternative splicing; Named isoforms=2; CC Name=Long; CC IsoId=O00142-1; Sequence=Displayed; CC Name=Short; CC IsoId=O00142-2; Sequence=VSP_003028; CC Note=No experimental confirmation available; CC -!- TISSUE SPECIFICITY: Predominantly expressed in liver, pancreas, CC muscle, and brain. CC -!- DISEASE: Defects in TK2 are a cause of myopathic mitochondrial DNA CC depletion syndrome (MDS) [MIM:609560]. MDS is a clinically CC heterogeneous group of disorders characterized by a reduction in CC mitochondrial DNA (mtDNA) copy number. Primary mtDNA depletion is CC inherited as an autosomal recessive trait and may affect single CC organs, typically muscle or liver, or multiple tissues. The CC myopathic form of mtDNA depletion syndrome is a slowly progressive CC mitochondrial disorder starting in childhood and associated with CC less severe depletion of mtDNA in skeletal muscle (66 to 86%) CC compared to the hepatocerebral form of mtDNA depletion syndrome CC which shows up to 99% mtDNA depletion in liver. CC -!- SIMILARITY: Belongs to the DCK/DGK family. CC -!- WEB RESOURCE: Name=GeneReviews; CC URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/TK2"; CC ----------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution-NoDerivs License CC ----------------------------------------------------------------------- DR EMBL; U77088; AAC51167.1; -; mRNA. DR EMBL; Y10498; CAA71523.3; -; mRNA. DR EMBL; AC010542; -; NOT_ANNOTATED_CDS; Genomic_DNA. DR IPI; IPI00215650; -. DR IPI; IPI00337439; -. DR UniGene; Hs.512619; -. DR STRING; O00142; -. DR PRIDE; O00142; -. DR Ensembl; ENST00000299697; ENSP00000299697; ENSG00000166548; Homo sapiens. DR GeneCards; GC16M065102; -. DR H-InvDB; HIX0013113; -. DR H-InvDB; HIX0021286; -. DR HGNC; HGNC:11831; TK2. DR MIM; 188250; gene. DR MIM; 609560; phenotype. DR Orphanet; 35698; Mitochondrial DNA depletion syndrome. DR PharmGKB; PA134884391; -. DR HOVERGEN; O00142; -. DR BRENDA; 2.7.1.21; 247. DR Reactome; REACT_152; Cell Cycle, Mitotic. DR Reactome; REACT_1698; Metablism of nucleotides. DR ArrayExpress; O00142; -. DR Bgee; O00142; -. DR CleanEx; HS_TK2; -. DR Genevestigator; O00142; -. DR GermOnline; ENSG00000166548; Homo sapiens. DR GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW. DR GO; GO:0004797; F:thymidine kinase activity; TAS:ProtInc. PE 1: Evidence at protein level; KW Alternative splicing; ATP-binding; Complete proteome; KW Direct protein sequencing; Disease mutation; DNA synthesis; Kinase; KW Mitochondrion; Nucleotide-binding; Transferase; Transit peptide. FT TRANSIT 1 33 Mitochondrion. FT CHAIN 34 265 Thymidine kinase 2, mitochondrial. FT /FTId=PRO_0000016842. FT NP_BIND 57 64 ATP (Potential). FT VAR_SEQ 1 41 MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPP FT -> MGAFCQRPSS (in isoform Short). FT /FTId=VSP_003028. FT VARIANT 53 53 I -> M (in MDS). FT /FTId=VAR_019419. FT VARIANT 64 64 T -> M (in MDS). FT /FTId=VAR_023790. FT VARIANT 108 108 T -> M (in MDS; reduction of activity). FT /FTId=VAR_019420. FT VARIANT 121 121 H -> N (in MDS). FT /FTId=VAR_019421. FT VARIANT 183 183 R -> W (in MDS). FT /FTId=VAR_023791. FT VARIANT 192 192 R -> K (in MDS; reduction of activity). FT /FTId=VAR_023792. FT VARIANT 212 212 I -> N (in MDS). FT /FTId=VAR_019422. FT CONFLICT 37 37 R -> Y (in Ref. 2; AA sequence). FT CONFLICT 61 61 S -> G (in Ref. 1; AAC51167). FT CONFLICT 238 238 D -> DH (in Ref. 2; CAA71523). FT CONFLICT 241 241 Missing (in Ref. 1; AAC51167). SQ SEQUENCE 265 AA; 31005 MW; 1E9CB62D0321A992 CRC64; MLLWPLRGWA ARALRCFGPG SRGSPASGPG PRRVQRRAWP PDKEQEKEKK SVICVEGNIA SGKTTCLEFF SNATDVEVLT EPVSKWRNVR GHNPLGLMYH DASRWGLTLQ TYVQLTMLDR HTRPQVSSVR LMERSIHSAR YIFVENLYRS GKMPEVDYVV LSEWFDWILR NMDVSVDLIV YLRTNPETCY QRLKKRCREE EKVIPLEYLE AIHHLHEEWL IKGSLFPMAA PVLVIEADHH MERMLELFEQ NRDRILTPEN RKHCP //