O00142 (KITM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Thymidine kinase 2, mitochondrial EC=2.7.1.21 Alternative name(s): Mt-TK | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 265 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Deoxyribonucleoside kinase that phosphorylates thymidine, deoxycytidine, and deoxyuridine. Also phosphorylates anti-viral and anti-cancer nucleoside analogs. |
| Catalytic activity | ATP + thymidine = ADP + thymidine 5'-phosphate. |
| Subunit structure | Monomer. |
| Subcellular location | |
| Tissue specificity | Predominantly expressed in liver, pancreas, muscle, and brain. |
| Involvement in disease | Defects in TK2 are a cause of mitochondrial DNA depletion syndrome type 2 (MTDPS2) [MIM:609560]. A disorder characterized primarily by childhood onset of muscle weakness associated with depletion of mtDNA in skeletal muscle. There is wide clinical variability; some patients have onset in infancy and show a rapidly progressive course with early death due to respiratory failure, whereas others have later onset of a slowly progressive myopathy. Ref.5 Ref.6 Ref.7 Ref.8 |
| Sequence similarities | Belongs to the DCK/DGK family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA synthesis |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation |
| Domain | Transit peptide |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | DNA replication Inferred from electronic annotation. Source: UniProtKB-KW pyrimidine base metabolic processTraceable author statement. Source: Reactome pyrimidine nucleoside salvageTraceable author statement. Source: Reactome |
| Cellular component | mitochondrial matrix Traceable author statement. Source: Reactome |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW phosphotransferase activity, alcohol group as acceptorInferred from electronic annotation. Source: InterPro thymidine kinase activityTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: O00142-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: O00142-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPP → MGAFCQRPSS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 33 | 33 | Mitochondrion Ref.2 | ||||||
| Chain | 34 – 265 | 232 | Thymidine kinase 2, mitochondrial | PRO_0000016842 | |||||
Regions | |||||||||
| Nucleotide binding | 57 – 65 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 133 | 1 | Proton acceptor Potential | ||||||
| Binding site | 81 | 1 | Substrate By similarity | ||||||
| Binding site | 99 | 1 | Substrate By similarity | ||||||
| Binding site | 110 | 1 | Substrate By similarity | ||||||
| Binding site | 134 | 1 | Substrate By similarity | ||||||
| Binding site | 201 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 41 | 41 | MLLWP…RAWPP → MGAFCQRPSS in isoform Short. | VSP_003028 | |||||
| Natural variant | 53 | 1 | I → M in MTDPS2. Ref.6 | VAR_019419 | |||||
| Natural variant | 64 | 1 | T → M in MTDPS2. Ref.8 | VAR_023790 | |||||
| Natural variant | 108 | 1 | T → M in MTDPS2; reduction of activity. Ref.6 Ref.7 | VAR_019420 | |||||
| Natural variant | 121 | 1 | H → N in MTDPS2. Ref.5 Ref.6 | VAR_019421 | |||||
| Natural variant | 183 | 1 | R → W in MTDPS2. Ref.8 | VAR_023791 | |||||
| Natural variant | 192 | 1 | R → K in MTDPS2; reduction of activity. Ref.7 | VAR_023792 | |||||
| Natural variant | 212 | 1 | I → N in MTDPS2. Ref.5 | VAR_019422 | |||||
Experimental info | |||||||||
| Sequence conflict | 37 | 1 | R → Y AA sequence Ref.2 | ||||||
| Sequence conflict | 61 | 1 | S → G in AAC51167. Ref.1 | ||||||
| Sequence conflict | 238 | 1 | D → DH in CAA71523. Ref.2 | ||||||
| Sequence conflict | 241 | 1 | Missing in AAC51167. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the cDNA and chromosome localization of the gene for human thymidine kinase 2." Johansson M., Karlsson A. J. Biol. Chem. 272:8454-8458(1997) [PubMed: 9079672] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Tissue: Liver. |
| [2] | "Human thymidine kinase 2: molecular cloning and characterisation of the enzyme activity with antiviral and cytostatic nucleoside substrates." Wang L., Munch-Petersen B., Herrstroem Sjoeberg A., Hellman U., Bergman T., Joernvall H., Eriksson S. FEBS Lett. 443:170-174(1999) [PubMed: 9989599] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), PROTEIN SEQUENCE OF 34-61 (ISOFORM LONG), CHARACTERIZATION. Tissue: Brain. |
| [3] | Wang L. Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [4] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Mutant mitochondrial thymidine kinase in mitochondrial DNA depletion myopathy." Saada A., Shaag A., Mandel H., Nevo Y., Eriksson S., Elpeleg O. Nat. Genet. 29:342-344(2001) [PubMed: 11687801] [Abstract] Cited for: VARIANTS MTDPS2 ASN-121 AND ASN-212. |
| [6] | "Mitochondrial DNA depletion: mutations in thymidine kinase gene with myopathy and SMA." Mancuso M., Salviati L., Sacconi S., Otaegui D., Camano P., Marina A., Bacman S., Moraes C.T., Carlo J.R., Garcia M., Garcia-Alvarez M., Monzon L., Naini A.B., Hirano M., Bonilla E., Taratuto A.L., DiMauro S., Vu T.H. Neurology 59:1197-1202(2002) [PubMed: 12391347] [Abstract] Cited for: VARIANTS MTDPS2 MET-53; MET-108 AND ASN-121. |
| [7] | "Molecular insight into mitochondrial DNA depletion syndrome in two patients with novel mutations in the deoxyguanosine kinase and thymidine kinase 2 genes." Wang L., Limongelli A., Vila M.R., Carrara F., Zeviani M., Eriksson S. Mol. Genet. Metab. 84:75-82(2005) [PubMed: 15639197] [Abstract] Cited for: VARIANTS MTDPS2 MET-108 AND LYS-192, CHARACTERIZATION OF VARIANTS MTDPS2 MET-108 AND LYS-192. |
| [8] | "Novel mutations in the thymidine kinase 2 gene (TK2) associated with fatal mitochondrial myopathy and mitochondrial DNA depletion." Tulinius M., Moslemi A.-R., Darin N., Holme E., Oldfors A. Neuromuscul. Disord. 15:412-415(2005) [PubMed: 15907288] [Abstract] Cited for: VARIANTS MTDPS2 MET-64 AND TRP-183. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U77088 mRNA. Translation: AAC51167.1. Y10498 mRNA. Translation: CAA71523.3. AC010542 Genomic DNA. No translation available. |
| IPI | IPI00215650. IPI00337439. |
| RefSeq | NP_001166114.1. NM_001172643.1. NP_004605.4. NM_004614.4. |
| UniGene | Hs.512619. |
3D structure databases | |
| ProteinModelPortal | O00142. |
| SMR | O00142. Positions 43-239. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O00142. |
Proteomic databases | |
| PRIDE | O00142. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000299697; ENSP00000299697; ENSG00000166548. |
| GeneID | 7084. |
| KEGG | hsa:7084. |
Organism-specific databases | |
| CTD | 7084. |
| GeneCards | GC16M066543. |
| H-InvDB | HIX0013113. HIX0021286. |
| HGNC | HGNC:11831. TK2. |
| HPA | HPA041162. |
| MIM | 188250. gene. 609560. phenotype. |
| neXtProt | NX_O00142. |
| Orphanet | 254875. Mitochondrial DNA depletion syndrome, myopathic form. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG14767. |
| HOVERGEN | HBG006216. |
| InParanoid | O00142. |
| OrthoDB | EOG4B8JF5. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.21. 2681. |
| Reactome | REACT_111217. Metabolism. REACT_152. Cell Cycle, Mitotic. |
Gene expression databases | |
| ArrayExpress | O00142. |
| Bgee | O00142. |
| CleanEx | HS_TK2. |
| Genevestigator | O00142. |
| GermOnline | ENSG00000166548. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002624. Deoxynucleoside_kinase. [Graphical view] |
| KO | K00857. |
| PANTHER | PTHR10513. dNK. 1 hit. |
| Pfam | PF01712. dNK. 1 hit. [Graphical view] |
| PIRSF | PIRSF000705. DNK. 1 hit. |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | KITM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00142 Secondary accession number(s): O15238 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with