Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O00139

- KIF2A_HUMAN

UniProt

O00139 - KIF2A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Kinesin-like protein KIF2A

Gene

KIF2A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi313 – 3208ATP

GO - Molecular functioni

  1. ATPase activity Source: RefGenome
  2. ATP binding Source: UniProtKB-KW
  3. microtubule motor activity Source: RefGenome
  4. motor activity Source: ProtInc

GO - Biological processi

  1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome
  2. ATP catabolic process Source: GOC
  3. blood coagulation Source: Reactome
  4. cell differentiation Source: UniProtKB-KW
  5. metabolic process Source: GOC
  6. microtubule-based movement Source: RefGenome
  7. microtubule depolymerization Source: RefGenome
  8. mitotic cell cycle Source: Reactome
  9. mitotic nuclear division Source: UniProtKB-KW
  10. mitotic spindle organization Source: UniProtKB
  11. nervous system development Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Motor protein

Keywords - Biological processi

Cell cycle, Cell division, Differentiation, Mitosis, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_121399. MHC class II antigen presentation.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_25201. Kinesins.
REACT_682. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Short name:
hK2
Gene namesi
Name:KIF2A
Synonyms:KIF2, KNS2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:6318. KIF2A.

Subcellular locationi

Cytoplasm By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cytoplasmcytoskeletonspindle pole. Cytoplasmcytoskeletonspindle
Note: Localized to the spindle microtubules and spindle poles from prophase to metaphase. Efficient targeting to spindle microtubules and spindle poles requires the kinase activity of PLK1. Recruited to mitotic spindles by interaction with PSRC1.

GO - Cellular componenti

  1. centrosome Source: UniProtKB
  2. cytosol Source: Reactome
  3. kinesin complex Source: RefGenome
  4. membrane Source: UniProtKB
  5. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Cortical dysplasia, complex, with other brain malformations 3 (CDCBM3) [MIM:615411]: A disorder of aberrant neuronal migration and disturbed axonal guidance. Clinical features include early-onset epilepsy, and various malformations of cortical development such as agyria, posterior or frontal pachygyria, subcortical band heterotopia, and thin corpus callosum.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti317 – 3171S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 Publication
VAR_070575
Natural varianti321 – 3211H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 Publication
VAR_070576

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi615411. phenotype.
PharmGKBiPA162393356.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 706706Kinesin-like protein KIF2APRO_0000125414Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei75 – 751Phosphoserine1 Publication
Modified residuei78 – 781Phosphothreonine1 Publication
Modified residuei102 – 1021N6-acetyllysineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO00139.
PaxDbiO00139.
PRIDEiO00139.

PTM databases

PhosphoSiteiO00139.

Expressioni

Gene expression databases

BgeeiO00139.
CleanExiHS_KIF2A.
ExpressionAtlasiO00139. baseline and differential.
GenevestigatoriO00139.

Organism-specific databases

HPAiHPA004716.

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.3 Publications

Protein-protein interaction databases

BioGridi109997. 8 interactions.
IntActiO00139. 4 interactions.
MINTiMINT-2997391.
STRINGi9606.ENSP00000385000.

Structurei

Secondary structure

1
706
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi197 – 2059Combined sources
Beta strandi223 – 2308Combined sources
Helixi235 – 2395Combined sources
Beta strandi250 – 26112Combined sources
Beta strandi267 – 2759Combined sources
Beta strandi277 – 2804Combined sources
Helixi286 – 2927Combined sources
Helixi295 – 3028Combined sources
Beta strandi306 – 3138Combined sources
Helixi319 – 3235Combined sources
Helixi338 – 34912Combined sources
Helixi353 – 3564Combined sources
Turni357 – 3593Combined sources
Beta strandi361 – 37010Combined sources
Beta strandi373 – 3764Combined sources
Turni377 – 3815Combined sources
Beta strandi383 – 3875Combined sources
Beta strandi395 – 3973Combined sources
Helixi407 – 42115Combined sources
Beta strandi434 – 45724Combined sources
Helixi472 – 49726Combined sources
Helixi499 – 5013Combined sources
Helixi504 – 5063Combined sources
Helixi508 – 5125Combined sources
Helixi514 – 5185Combined sources
Beta strandi522 – 5309Combined sources
Helixi534 – 5363Combined sources
Helixi537 – 54812Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2GRYX-ray2.35A153-553[»]
ProteinModelPortaliO00139.
SMRiO00139. Positions 162-550.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00139.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini223 – 553331Kinesin motorPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 217217GlobularSequence AnalysisAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili660 – 69940Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5059.
GeneTreeiENSGT00770000120451.
HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiO00139.
KOiK10393.
OMAiNKKETVM.
OrthoDBiEOG7K9K2C.
PhylomeDBiO00139.
TreeFamiTF105222.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: O00139-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE EIEPSPETPP PPASSAKVNK IVKNRRTVAS
110 120 130 140 150
IKNDPPSRDN RVVGSARARP SQFPEQSSSA QQNGSVSDIS PVQAAKKEFG
160 170 180 190 200
PPSRRKSNCV KEVEKLQEKR EKRRLQQQEL REKRAQDVDA TNPNYEIMCM
210 220 230 240 250
IRDFRGSLDY RPLTTADPID EHRICVCVRK RPLNKKETQM KDLDVITIPS
260 270 280 290 300
KDVVMVHEPK QKVDLTRYLE NQTFRFDYAF DDSAPNEMVY RFTARPLVET
310 320 330 340 350
IFERGMATCF AYGQTGSGKT HTMGGDFSGK NQDCSKGIYA LAARDVFLML
360 370 380 390 400
KKPNYKKLEL QVYATFFEIY SGKVFDLLNR KTKLRVLEDG KQQVQVVGLQ
410 420 430 440 450
EREVKCVEDV LKLIDIGNSC RTSGQTSANA HSSRSHAVFQ IILRRKGKLH
460 470 480 490 500
GKFSLIDLAG NERGADTSSA DRQTRLEGAE INKSLLALKE CIRALGRNKP
510 520 530 540 550
HTPFRASKLT QVLRDSFIGE NSRTCMIATI SPGMASCENT LNTLRYANRV
560 570 580 590 600
KELTVDPTAA GDVRPIMHHP PNQIDDLETQ WGVGSSPQRD DLKLLCEQNE
610 620 630 640 650
EEVSPQLFTF HEAVSQMVEM EEQVVEDHRA VFQESIRWLE DEKALLEMTE
660 670 680 690 700
EVDYDVDSYA TQLEAILEQK IDILTELRDK VKSFRAALQE EEQASKQINP

KRPRAL
Length:706
Mass (Da):79,955
Last modified:October 2, 2007 - v3
Checksum:iA407D84B6BD04ACF
GO
Isoform 1 (identifier: O00139-1) [UniParc]FASTAAdd to Basket

Also known as: HK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Show »
Length:679
Mass (Da):76,955
Checksum:iABB522C323822AF6
GO
Isoform 2 (identifier: O00139-2) [UniParc]FASTAAdd to Basket

Also known as: HK2s

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     134-153: GSVSDISPVQAAKKEFGPPS → A

Show »
Length:660
Mass (Da):75,043
Checksum:i8975B0872C83FED9
GO
Isoform 4 (identifier: O00139-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     552-552: E → EFGISPSDIPFSQGSGSRPDLSPSYEYDDFSPSVTRVKE

Note: Contains a phosphoserine at position 579 (By similarity). No experimental confirmation available.By similarity

Show »
Length:744
Mass (Da):84,089
Checksum:i9948FA52D473F3B0
GO
Isoform 5 (identifier: O00139-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MATANFGKIQIGIYVEIKRSD → M

Note: Gene prediction based on EST data.

Show »
Length:686
Mass (Da):77,749
Checksum:iA7845ECBC1EDA7D9
GO

Sequence cautioni

The sequence AAP84320.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti143 – 1431Q → H in AAP84320. 1 PublicationCurated
Sequence conflicti153 – 1531S → SHLFFSA in AAP84320. 1 PublicationCurated
Sequence conflicti295 – 2951R → K in CAA69621. (PubMed:9177777)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti317 – 3171S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 Publication
VAR_070575
Natural varianti321 – 3211H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 Publication
VAR_070576

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2727Missing in isoform 1 and isoform 2. 3 PublicationsVSP_028374Add
BLAST
Alternative sequencei1 – 2121MATAN…IKRSD → M in isoform 5. CuratedVSP_047373Add
BLAST
Alternative sequencei134 – 15320GSVSD…FGPPS → A in isoform 2. 2 PublicationsVSP_028375Add
BLAST
Alternative sequencei552 – 5521E → EFGISPSDIPFSQGSGSRPD LSPSYEYDDFSPSVTRVKE in isoform 4. 1 PublicationVSP_028376

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA. Translation: CAA69621.1.
AK302270 mRNA. Translation: BAG63616.1.
EF560716 mRNA. Translation: ABQ59026.1.
EF560728 mRNA. Translation: ABQ59038.1.
AC016637 Genomic DNA. No translation available.
AC034242 Genomic DNA. No translation available.
AC114982 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51388.1.
CH471137 Genomic DNA. Translation: EAW51390.1.
BC031828 mRNA. Translation: AAH31828.1.
AY317140 mRNA. Translation: AAP84320.1. Different initiation.
CCDSiCCDS3980.2. [O00139-3]
CCDS47216.1. [O00139-4]
CCDS58949.1. [O00139-5]
RefSeqiNP_001091981.1. NM_001098511.2. [O00139-4]
NP_001230881.1. NM_001243952.1. [O00139-5]
NP_004511.2. NM_004520.4. [O00139-3]
UniGeneiHs.558351.

Genome annotation databases

EnsembliENST00000381103; ENSP00000370493; ENSG00000068796. [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796. [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796. [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796. [O00139-2]
GeneIDi3796.
KEGGihsa:3796.
UCSCiuc003jsy.4. human. [O00139-3]
uc003jsz.4. human. [O00139-4]
uc010iwp.3. human. [O00139-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA. Translation: CAA69621.1 .
AK302270 mRNA. Translation: BAG63616.1 .
EF560716 mRNA. Translation: ABQ59026.1 .
EF560728 mRNA. Translation: ABQ59038.1 .
AC016637 Genomic DNA. No translation available.
AC034242 Genomic DNA. No translation available.
AC114982 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51388.1 .
CH471137 Genomic DNA. Translation: EAW51390.1 .
BC031828 mRNA. Translation: AAH31828.1 .
AY317140 mRNA. Translation: AAP84320.1 . Different initiation.
CCDSi CCDS3980.2. [O00139-3 ]
CCDS47216.1. [O00139-4 ]
CCDS58949.1. [O00139-5 ]
RefSeqi NP_001091981.1. NM_001098511.2. [O00139-4 ]
NP_001230881.1. NM_001243952.1. [O00139-5 ]
NP_004511.2. NM_004520.4. [O00139-3 ]
UniGenei Hs.558351.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2GRY X-ray 2.35 A 153-553 [» ]
ProteinModelPortali O00139.
SMRi O00139. Positions 162-550.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109997. 8 interactions.
IntActi O00139. 4 interactions.
MINTi MINT-2997391.
STRINGi 9606.ENSP00000385000.

PTM databases

PhosphoSitei O00139.

Proteomic databases

MaxQBi O00139.
PaxDbi O00139.
PRIDEi O00139.

Protocols and materials databases

DNASUi 3796.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000381103 ; ENSP00000370493 ; ENSG00000068796 . [O00139-5 ]
ENST00000401507 ; ENSP00000385622 ; ENSG00000068796 . [O00139-3 ]
ENST00000407818 ; ENSP00000385000 ; ENSG00000068796 . [O00139-4 ]
ENST00000506857 ; ENSP00000423772 ; ENSG00000068796 . [O00139-2 ]
GeneIDi 3796.
KEGGi hsa:3796.
UCSCi uc003jsy.4. human. [O00139-3 ]
uc003jsz.4. human. [O00139-4 ]
uc010iwp.3. human. [O00139-2 ]

Organism-specific databases

CTDi 3796.
GeneCardsi GC05P061601.
H-InvDB HIX0020778.
HGNCi HGNC:6318. KIF2A.
HPAi HPA004716.
MIMi 602591. gene.
615411. phenotype.
neXtProti NX_O00139.
PharmGKBi PA162393356.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5059.
GeneTreei ENSGT00770000120451.
HOGENOMi HOG000231329.
HOVERGENi HBG003875.
InParanoidi O00139.
KOi K10393.
OMAi NKKETVM.
OrthoDBi EOG7K9K2C.
PhylomeDBi O00139.
TreeFami TF105222.

Enzyme and pathway databases

Reactomei REACT_121399. MHC class II antigen presentation.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_25201. Kinesins.
REACT_682. Mitotic Prometaphase.

Miscellaneous databases

EvolutionaryTracei O00139.
GeneWikii KIF2A.
GenomeRNAii 3796.
NextBioi 14903.
PROi O00139.
SOURCEi Search...

Gene expression databases

Bgeei O00139.
CleanExi HS_KIF2A.
ExpressionAtlasi O00139. baseline and differential.
Genevestigatori O00139.

Family and domain databases

Gene3Di 3.40.850.10. 1 hit.
InterProi IPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view ]
PANTHERi PTHR24115. PTHR24115. 1 hit.
Pfami PF00225. Kinesin. 1 hit.
[Graphical view ]
PRINTSi PR00380. KINESINHEAVY.
SMARTi SM00129. KISc. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
PROSITEi PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel human kinesin-related gene (HK2) by the cDNA differential display technique."
    Debernardi S., Fontanella E., de Gregorio L., Pierotti M.A., Delia D.
    Genomics 42:67-73(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Fetal brain and Salivary gland.
  4. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  7. Sha J.H., Zhou Z.M., Li J.M.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 60-706 (ISOFORMS 1/3).
    Tissue: Testis.
  8. "Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference."
    Zhu C., Zhao J., Bibikova M., Leverson J.D., Bossy-Wetzel E., Fan J.-B., Abraham R.T., Jiang W.
    Mol. Biol. Cell 16:3187-3199(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "The kinesin-13 proteins Kif2a, Kif2b, and Kif2c/MCAK have distinct roles during mitosis in human cells."
    Manning A.L., Ganem N.J., Bakhoum S.F., Wagenbach M., Wordeman L., Compton D.A.
    Mol. Biol. Cell 18:2970-2979(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. "DDA3 recruits microtubule depolymerase Kif2a to spindle poles and controls spindle dynamics and mitotic chromosome movement."
    Jang C.Y., Wong J., Coppinger J.A., Seki A., Yates J.R. III, Fang G.
    J. Cell Biol. 181:255-267(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH PSRC1, SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY.
  11. "Plk1 and Aurora A regulate the depolymerase activity and the cellular localization of Kif2a."
    Jang C.Y., Coppinger J.A., Seki A., Yates J.R. III, Fang G.
    J. Cell Sci. 122:1334-1341(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PLK1 AND AURKA, SUBCELLULAR LOCATION, PHOSPHORYLATION, IDENTIFICATION BY MASS SPECTROMETRY.
  12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75 AND THR-78, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Crystal structure of the human KIF2 motor domain in complex with ADP."
    Structural genomics consortium (SGC)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 153-553 IN COMPLEX WITH ADP.
  15. Cited for: VARIANTS CDCBM3 ASN-317 AND ASP-321, CHARACTERIZATION OF VARIANTS CDCBM3 ASN-317 AND ASP-321.

Entry informationi

Entry nameiKIF2A_HUMAN
AccessioniPrimary (citable) accession number: O00139
Secondary accession number(s): A5YM42
, A5YM54, B4DY54, D3DW97, E9PB70, Q7Z5I3, Q8N5Q7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: October 2, 2007
Last modified: November 26, 2014
This is version 132 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

HeLa cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3