Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2A

Gene

KIF2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi313 – 320ATP8

GO - Molecular functioni

  • ATPase activity Source: GO_Central
  • ATP binding Source: UniProtKB-KW
  • microtubule motor activity Source: GO_Central
  • motor activity Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Motor protein

Keywords - Biological processi

Cell cycle, Cell division, Differentiation, Mitosis, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000068796-MONOMER.
ReactomeiR-HSA-2132295. MHC class II antigen presentation.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-68877. Mitotic Prometaphase.
R-HSA-983189. Kinesins.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Short name:
hK2
Gene namesi
Name:KIF2A
Synonyms:KIF2, KNS2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:6318. KIF2A.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytosol Source: Reactome
  • kinesin complex Source: GO_Central
  • membrane Source: UniProtKB
  • microtubule Source: UniProtKB-KW
  • nucleolus Source: HPA
  • nucleus Source: HPA
  • sperm principal piece Source: Ensembl
  • spindle pole Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Cortical dysplasia, complex, with other brain malformations 3 (CDCBM3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of aberrant neuronal migration and disturbed axonal guidance. Clinical features include early-onset epilepsy, and various malformations of cortical development such as agyria, posterior or frontal pachygyria, subcortical band heterotopia, and thin corpus callosum.
See also OMIM:615411
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070575317S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant rs587777034dbSNPEnsembl.1
Natural variantiVAR_070576321H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant rs587777033dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi3796.
MalaCardsiKIF2A.
MIMi615411. phenotype.
OpenTargetsiENSG00000068796.
PharmGKBiPA162393356.

Polymorphism and mutation databases

BioMutaiKIF2A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001254141 – 706Kinesin-like protein KIF2AAdd BLAST706

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei75PhosphoserineCombined sources1
Modified residuei78PhosphothreonineCombined sources1
Modified residuei97PhosphothreonineCombined sources1
Modified residuei100PhosphoserineCombined sources1
Modified residuei102N6-acetyllysineBy similarity1
Modified residuei135PhosphoserineCombined sources1
Modified residuei140PhosphoserineCombined sources1
Isoform 4 (identifier: O00139-4)
Modified residuei579Phosphoserine By similarityBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO00139.
PeptideAtlasiO00139.
PRIDEiO00139.

PTM databases

iPTMnetiO00139.
PhosphoSitePlusiO00139.

Expressioni

Gene expression databases

BgeeiENSG00000068796.
CleanExiHS_KIF2A.
ExpressionAtlasiO00139. baseline and differential.
GenevisibleiO00139. HS.

Organism-specific databases

HPAiHPA004715.
HPA004716.

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FAM13CQ8NE313EBI-2692369,EBI-751248
LARP1BQ659C43EBI-2692369,EBI-3940258
MRPL53Q96EL33EBI-2692369,EBI-2513715

Protein-protein interaction databases

BioGridi109997. 64 interactors.
DIPiDIP-56112N.
IntActiO00139. 54 interactors.
MINTiMINT-2997391.

Structurei

Secondary structure

1706
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi197 – 205Combined sources9
Beta strandi223 – 230Combined sources8
Helixi235 – 239Combined sources5
Beta strandi250 – 261Combined sources12
Beta strandi267 – 275Combined sources9
Beta strandi277 – 280Combined sources4
Helixi286 – 292Combined sources7
Helixi295 – 302Combined sources8
Beta strandi306 – 313Combined sources8
Helixi319 – 323Combined sources5
Helixi338 – 349Combined sources12
Helixi353 – 356Combined sources4
Turni357 – 359Combined sources3
Beta strandi361 – 370Combined sources10
Beta strandi373 – 376Combined sources4
Turni377 – 381Combined sources5
Beta strandi383 – 387Combined sources5
Beta strandi395 – 397Combined sources3
Helixi407 – 421Combined sources15
Beta strandi434 – 457Combined sources24
Helixi472 – 497Combined sources26
Helixi499 – 501Combined sources3
Helixi504 – 506Combined sources3
Helixi508 – 512Combined sources5
Helixi514 – 518Combined sources5
Beta strandi522 – 530Combined sources9
Helixi534 – 536Combined sources3
Helixi537 – 548Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GRYX-ray2.35A153-553[»]
ProteinModelPortaliO00139.
SMRiO00139.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO00139.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini223 – 553Kinesin motorPROSITE-ProRule annotationAdd BLAST331

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 217GlobularSequence analysisAdd BLAST217

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili660 – 699Sequence analysisAdd BLAST40

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00860000133670.
HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiO00139.
KOiK10393.
OMAiKNEPPPR.
OrthoDBiEOG091G06V3.
PhylomeDBiO00139.
TreeFamiTF105222.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: O00139-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE EIEPSPETPP PPASSAKVNK IVKNRRTVAS
110 120 130 140 150
IKNDPPSRDN RVVGSARARP SQFPEQSSSA QQNGSVSDIS PVQAAKKEFG
160 170 180 190 200
PPSRRKSNCV KEVEKLQEKR EKRRLQQQEL REKRAQDVDA TNPNYEIMCM
210 220 230 240 250
IRDFRGSLDY RPLTTADPID EHRICVCVRK RPLNKKETQM KDLDVITIPS
260 270 280 290 300
KDVVMVHEPK QKVDLTRYLE NQTFRFDYAF DDSAPNEMVY RFTARPLVET
310 320 330 340 350
IFERGMATCF AYGQTGSGKT HTMGGDFSGK NQDCSKGIYA LAARDVFLML
360 370 380 390 400
KKPNYKKLEL QVYATFFEIY SGKVFDLLNR KTKLRVLEDG KQQVQVVGLQ
410 420 430 440 450
EREVKCVEDV LKLIDIGNSC RTSGQTSANA HSSRSHAVFQ IILRRKGKLH
460 470 480 490 500
GKFSLIDLAG NERGADTSSA DRQTRLEGAE INKSLLALKE CIRALGRNKP
510 520 530 540 550
HTPFRASKLT QVLRDSFIGE NSRTCMIATI SPGMASCENT LNTLRYANRV
560 570 580 590 600
KELTVDPTAA GDVRPIMHHP PNQIDDLETQ WGVGSSPQRD DLKLLCEQNE
610 620 630 640 650
EEVSPQLFTF HEAVSQMVEM EEQVVEDHRA VFQESIRWLE DEKALLEMTE
660 670 680 690 700
EVDYDVDSYA TQLEAILEQK IDILTELRDK VKSFRAALQE EEQASKQINP

KRPRAL
Length:706
Mass (Da):79,955
Last modified:October 2, 2007 - v3
Checksum:iA407D84B6BD04ACF
GO
Isoform 1 (identifier: O00139-1) [UniParc]FASTAAdd to basket
Also known as: HK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Show »
Length:679
Mass (Da):76,955
Checksum:iABB522C323822AF6
GO
Isoform 2 (identifier: O00139-2) [UniParc]FASTAAdd to basket
Also known as: HK2s

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     134-153: GSVSDISPVQAAKKEFGPPS → A

Show »
Length:660
Mass (Da):75,043
Checksum:i8975B0872C83FED9
GO
Isoform 4 (identifier: O00139-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     552-552: E → EFGISPSDIPFSQGSGSRPDLSPSYEYDDFSPSVTRVKE

Note: No experimental confirmation available.By similarity
Show »
Length:744
Mass (Da):84,089
Checksum:i9948FA52D473F3B0
GO
Isoform 5 (identifier: O00139-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MATANFGKIQIGIYVEIKRSD → M

Note: Gene prediction based on EST data.
Show »
Length:686
Mass (Da):77,749
Checksum:iA7845ECBC1EDA7D9
GO

Sequence cautioni

The sequence AAP84320 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti143Q → H in AAP84320 (Ref. 7) Curated1
Sequence conflicti153S → SHLFFSA in AAP84320 (Ref. 7) Curated1
Sequence conflicti295R → K in CAA69621 (PubMed:9177777).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070575317S → N in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant rs587777034dbSNPEnsembl.1
Natural variantiVAR_070576321H → D in CDCBM3; results in abnormal cellular localization with predominant decoration of microtubules rather than diffuse punctiform cytoplasmic and nuclear distribution as observed for wild-type protein. 1 PublicationCorresponds to variant rs587777033dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0283741 – 27Missing in isoform 1 and isoform 2. 3 PublicationsAdd BLAST27
Alternative sequenceiVSP_0473731 – 21MATAN…IKRSD → M in isoform 5. CuratedAdd BLAST21
Alternative sequenceiVSP_028375134 – 153GSVSD…FGPPS → A in isoform 2. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_028376552E → EFGISPSDIPFSQGSGSRPD LSPSYEYDDFSPSVTRVKE in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA. Translation: CAA69621.1.
AK302270 mRNA. Translation: BAG63616.1.
EF560716 mRNA. Translation: ABQ59026.1.
EF560728 mRNA. Translation: ABQ59038.1.
AC016637 Genomic DNA. No translation available.
AC034242 Genomic DNA. No translation available.
AC114982 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51388.1.
CH471137 Genomic DNA. Translation: EAW51390.1.
BC031828 mRNA. Translation: AAH31828.1.
AY317140 mRNA. Translation: AAP84320.1. Different initiation.
CCDSiCCDS3980.2. [O00139-3]
CCDS47216.1. [O00139-4]
CCDS58949.1. [O00139-5]
RefSeqiNP_001091981.1. NM_001098511.2. [O00139-4]
NP_001230881.1. NM_001243952.1. [O00139-5]
NP_004511.2. NM_004520.4. [O00139-3]
UniGeneiHs.558351.

Genome annotation databases

EnsembliENST00000381103; ENSP00000370493; ENSG00000068796. [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796. [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796. [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796. [O00139-2]
GeneIDi3796.
KEGGihsa:3796.
UCSCiuc003jsx.5. human. [O00139-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08319 mRNA. Translation: CAA69621.1.
AK302270 mRNA. Translation: BAG63616.1.
EF560716 mRNA. Translation: ABQ59026.1.
EF560728 mRNA. Translation: ABQ59038.1.
AC016637 Genomic DNA. No translation available.
AC034242 Genomic DNA. No translation available.
AC114982 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51388.1.
CH471137 Genomic DNA. Translation: EAW51390.1.
BC031828 mRNA. Translation: AAH31828.1.
AY317140 mRNA. Translation: AAP84320.1. Different initiation.
CCDSiCCDS3980.2. [O00139-3]
CCDS47216.1. [O00139-4]
CCDS58949.1. [O00139-5]
RefSeqiNP_001091981.1. NM_001098511.2. [O00139-4]
NP_001230881.1. NM_001243952.1. [O00139-5]
NP_004511.2. NM_004520.4. [O00139-3]
UniGeneiHs.558351.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GRYX-ray2.35A153-553[»]
ProteinModelPortaliO00139.
SMRiO00139.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109997. 64 interactors.
DIPiDIP-56112N.
IntActiO00139. 54 interactors.
MINTiMINT-2997391.

PTM databases

iPTMnetiO00139.
PhosphoSitePlusiO00139.

Polymorphism and mutation databases

BioMutaiKIF2A.

Proteomic databases

EPDiO00139.
PeptideAtlasiO00139.
PRIDEiO00139.

Protocols and materials databases

DNASUi3796.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381103; ENSP00000370493; ENSG00000068796. [O00139-5]
ENST00000401507; ENSP00000385622; ENSG00000068796. [O00139-3]
ENST00000407818; ENSP00000385000; ENSG00000068796. [O00139-4]
ENST00000506857; ENSP00000423772; ENSG00000068796. [O00139-2]
GeneIDi3796.
KEGGihsa:3796.
UCSCiuc003jsx.5. human. [O00139-3]

Organism-specific databases

CTDi3796.
DisGeNETi3796.
GeneCardsiKIF2A.
H-InvDBHIX0020778.
HGNCiHGNC:6318. KIF2A.
HPAiHPA004715.
HPA004716.
MalaCardsiKIF2A.
MIMi602591. gene.
615411. phenotype.
neXtProtiNX_O00139.
OpenTargetsiENSG00000068796.
PharmGKBiPA162393356.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00860000133670.
HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiO00139.
KOiK10393.
OMAiKNEPPPR.
OrthoDBiEOG091G06V3.
PhylomeDBiO00139.
TreeFamiTF105222.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000068796-MONOMER.
ReactomeiR-HSA-2132295. MHC class II antigen presentation.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-68877. Mitotic Prometaphase.
R-HSA-983189. Kinesins.

Miscellaneous databases

EvolutionaryTraceiO00139.
GeneWikiiKIF2A.
GenomeRNAii3796.
PROiO00139.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000068796.
CleanExiHS_KIF2A.
ExpressionAtlasiO00139. baseline and differential.
GenevisibleiO00139. HS.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKIF2A_HUMAN
AccessioniPrimary (citable) accession number: O00139
Secondary accession number(s): A5YM42
, A5YM54, B4DY54, D3DW97, E9PB70, Q7Z5I3, Q8N5Q7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: October 2, 2007
Last modified: November 30, 2016
This is version 154 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

HeLa cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.