O00139 (KIF2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kinesin-like protein KIF2A Alternative name(s): Kinesin-2 Short name=hK2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 706 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity. Ref.7 Ref.8 Ref.11 |
| Subunit structure | |
| Subcellular location | Cytoplasm By similarity. Cytoplasm › cytoskeleton › centrosome. Cytoplasm › cytoskeleton › spindle pole. Cytoplasm › cytoskeleton › spindle. Note: Localized to the spindle microtubules and spindle poles from prophase to metaphase. Efficient targeting to spindle microtubules and spindle poles requires the kinase activity of PLK1. Recruited to mitotic spindles by interaction with PSRC1. Ref.11 Ref.12 |
| Miscellaneous | HeLa cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles. |
| Sequence similarities | Belongs to the kinesin-like protein family. MCAK/KIF2 subfamily. Contains 1 kinesin-motor domain. |
| Sequence caution | The sequence AAP84320.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: O00139-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: O00139-1) Also known as: HK2; The sequence of this isoform differs from the canonical sequence as follows: 1-27: Missing. | ||||||
| Isoform 2 (identifier: O00139-2) Also known as: HK2s; The sequence of this isoform differs from the canonical sequence as follows: 1-27: Missing. 134-153: GSVSDISPVQAAKKEFGPPS → A | ||||||
| Isoform 4 (identifier: O00139-4) The sequence of this isoform differs from the canonical sequence as follows: 552-552: E → EFGISPSDIPFSQGSGSRPDLSPSYEYDDFSPSVTRVKE | ||||||
| Note: Phosphorylated on Ser-579 (By similarity). No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 706 | 706 | Kinesin-like protein KIF2A | PRO_0000125414 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 218 – 552 | 335 | Kinesin-motor | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 313 – 320 | 8 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 217 | 217 | Globular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 660 – 699 | 40 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 75 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 78 | 1 | Phosphothreonine Ref.9 Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 140 | 1 | Phosphoserine Ref.9 Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 695 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 27 | 27 | Missing in isoform 1 and isoform 2. | VSP_028374 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 134 – 153 | 20 | GSVSD…FGPPS → A in isoform 2. | VSP_028375 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 552 | 1 | E → EFGISPSDIPFSQGSGSRPD LSPSYEYDDFSPSVTRVKE in isoform 4. | VSP_028376 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 143 | 1 | Q → H in AAP84320. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 153 | 1 | S → SHLFFSA in AAP84320. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 295 | 1 | R → K in CAA69621. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 197 – 205 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 223 – 230 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 235 – 239 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 261 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 267 – 275 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 277 – 280 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 286 – 292 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 302 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 313 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 319 – 323 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 349 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 353 – 356 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 357 – 359 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 361 – 370 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 373 – 376 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 377 – 381 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 383 – 387 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 395 – 397 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 407 – 421 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 434 – 457 | 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 472 – 497 | 26 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 499 – 501 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 504 – 506 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 508 – 512 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 514 – 518 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 522 – 530 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 534 – 536 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 537 – 548 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel human kinesin-related gene (HK2) by the cDNA differential display technique." Debernardi S., Fontanella E., de Gregorio L., Pierotti M.A., Delia D. Genomics 42:67-73(1997) [PubMed: 9177777] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Fetal brain and Salivary gland. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | Sha J.H., Zhou Z.M., Li J.M. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 60-706 (ISOFORMS 1/3). Tissue: Testis. |
| [7] | "Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference." Zhu C., Zhao J., Bibikova M., Leverson J.D., Bossy-Wetzel E., Fan J.-B., Abraham R.T., Jiang W. Mol. Biol. Cell 16:3187-3199(2005) [PubMed: 15843429] [Abstract] Cited for: FUNCTION. |
| [8] | "The kinesin-13 proteins Kif2a, Kif2b, and Kif2c/MCAK have distinct roles during mitosis in human cells." Manning A.L., Ganem N.J., Bakhoum S.F., Wagenbach M., Wordeman L., Compton D.A. Mol. Biol. Cell 18:2970-2979(2007) [PubMed: 17538014] [Abstract] Cited for: FUNCTION. |
| [9] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-78 AND SER-140, MASS SPECTROMETRY. Tissue: Cervix adenocarcinoma. |
| [10] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140 AND SER-695, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "DDA3 recruits microtubule depolymerase Kif2a to spindle poles and controls spindle dynamics and mitotic chromosome movement." Jang C.Y., Wong J., Coppinger J.A., Seki A., Yates J.R. III, Fang G. J. Cell Biol. 181:255-267(2008) [PubMed: 18411309] [Abstract] Cited for: FUNCTION, INTERACTION WITH PSRC1, SUBCELLULAR LOCATION, MASS SPECTROMETRY. |
| [12] | "Plk1 and Aurora A regulate the depolymerase activity and the cellular localization of Kif2a." Jang C.Y., Coppinger J.A., Seki A., Yates J.R. III, Fang G. J. Cell Sci. 122:1334-1341(2009) [PubMed: 19351716] [Abstract] Cited for: INTERACTION WITH PLK1 AND AURKA, SUBCELLULAR LOCATION, MASS SPECTROMETRY, PHOSPHORYLATION. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75 AND THR-78, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "Crystal structure of the human KIF2 motor domain in complex with ADP." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 153-553 IN COMPLEX WITH ADP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y08319 mRNA. Translation: CAA69621.1. AK302270 mRNA. Translation: BAG63616.1. EF560716 mRNA. Translation: ABQ59026.1. EF560728 mRNA. Translation: ABQ59038.1. CH471137 Genomic DNA. Translation: EAW51388.1. CH471137 Genomic DNA. Translation: EAW51390.1. BC031828 mRNA. Translation: AAH31828.1. AY317140 mRNA. Translation: AAP84320.1. Different initiation. | ||||||||||||
| IPI | IPI00010368. IPI00848334. IPI00867529. IPI00867746. | ||||||||||||
| RefSeq | NP_001091981.1. NM_001098511.2. NP_004511.2. NM_004520.4. | ||||||||||||
| UniGene | Hs.558351. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O00139. | ||||||||||||
| SMR | O00139. Positions 161-554. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O00139. 1 interaction. | ||||||||||||
| STRING | O00139. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O00139. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O00139. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000401507; ENSP00000385622; ENSG00000068796. | ||||||||||||
| GeneID | 3796. | ||||||||||||
| KEGG | hsa:3796. | ||||||||||||
| UCSC | uc003jsx.2. human. uc003jsy.2. human. uc003jsz.2. human. uc010iwp.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3796. | ||||||||||||
| GeneCards | GC05P061601. | ||||||||||||
| H-InvDB | HIX0004894. | ||||||||||||
| HGNC | HGNC:6318. KIF2A. | ||||||||||||
| HPA | HPA004716. | ||||||||||||
| MIM | 602591. gene. | ||||||||||||
| neXtProt | NX_O00139. | ||||||||||||
| PharmGKB | PA162393356. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG07981. | ||||||||||||
| GeneTree | ENSGT00600000084047. | ||||||||||||
| HOVERGEN | HBG003875. | ||||||||||||
| OMA | FSPSITR. | ||||||||||||
| OrthoDB | EOG44QT0D. | ||||||||||||
| PhylomeDB | O00139. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. REACT_383. DNA Replication. REACT_604. Hemostasis. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O00139. | ||||||||||||
| Bgee | O00139. | ||||||||||||
| CleanEx | HS_KIF2A. | ||||||||||||
| Genevestigator | O00139. | ||||||||||||
| GermOnline | ENSG00000068796. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR019821. Kinesin_motor_CS. IPR001752. Kinesin_motor_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.40.850.10. kinesin_motor. 1 hit. | ||||||||||||
| KO | K10393. | ||||||||||||
| Pfam | PF00225. Kinesin. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00380. KINESINHEAVY. | ||||||||||||
| SMART | SM00129. KISc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00411. KINESIN_MOTOR_DOMAIN1. 1 hit. PS50067. KINESIN_MOTOR_DOMAIN2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 14903. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | KIF2A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00139 Secondary accession number(s): A5YM42 Q8N5Q7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with