Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Golgin subfamily A member 8M

Gene

GOLGA8M

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Protein inferred from homologyi

Names & Taxonomyi

Protein namesi
Recommended name:
Golgin subfamily A member 8M
Gene namesi
Name:GOLGA8MImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:44404. GOLGA8M.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 632632Golgin subfamily A member 8MPRO_0000420860Add
BLAST

Proteomic databases

MaxQBiH3BSY2.
PaxDbiH3BSY2.
PRIDEiH3BSY2.

PTM databases

iPTMnetiH3BSY2.
PhosphoSiteiH3BSY2.

Expressioni

Gene expression databases

BgeeiENSG00000188626.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000456927.

Structurei

3D structure databases

ProteinModelPortaliH3BSY2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili86 – 15469Sequence analysisAdd
BLAST
Coiled coili209 – 421213Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the GOLGA8 family.Sequence analysis

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4725. Eukaryota.
ENOG410ZIE4. LUCA.
GeneTreeiENSGT00530000062932.
HOGENOMiHOG000218631.
InParanoidiH3BSY2.
OMAiEGREAMS.
OrthoDBiEOG091G0DDT.

Family and domain databases

InterProiIPR024858. Golgin_A.
[Graphical view]
PfamiPF15070. GOLGA2L5. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: H3BSY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEETQHNKL AAAKKKLKEY WQKNSPRVPA GANRNRKTNG SIPQTATSGG
60 70 80 90 100
CQPPGDSATG FHREGPTSSA TLKDLESPCQ ERAVVLDSRS VEISQLKNTI
110 120 130 140 150
KSLKQQKKQV EHQLEEEKKA NNKKQKAKRV LEVQLQTLNI QKEELNTDLY
160 170 180 190 200
HMKRSLRYFE EKSKDLAVRL QHSLQRKGEL ESVLSDVMAT QKKKANQLSS
210 220 230 240 250
PSKAGTEWKL EQSMREEALL KVQLTQLKES FQQVQLERDE YSEHLKGERA
260 270 280 290 300
RWQQRMRKMS QEICTLKKEK QQDMRRVEKL ERSLSKLKNQ MAEPLPPEPP
310 320 330 340 350
AVPSEVELQH LRKELERVAG ELQAQVKNNQ RISLLNQRQE ERIREQEERL
360 370 380 390 400
RKQEERIQEQ HKSLQQLAKP QSVFEEPNNE NKSTLQLEQQ VKELQEKLGE
410 420 430 440 450
EHLEAASQQN QQLTAQLSLM ALPGEGHGGE HLDSEGEEAP QPMPSVPEDP
460 470 480 490 500
ESREAMSSFM DHLEEKADLS ELVKKQELRF IQYWQERCHQ KIHHLLSEPG
510 520 530 540 550
GRAKDAALGG GHHQAGAQGG DEGEAAGAAA DGIAAYSNYN NGHRKFLAAA
560 570 580 590 600
HNSADEPGPG APAPQELGAA DKHGDLCEVS LTSSAQGEAR EDPLLDKPTA
610 620 630
QPIVQDHQEH PGLGSNCCVP FFCWAWLPRR RR
Note: No experimental confirmation available.Curated
Length:632
Mass (Da):71,498
Last modified:April 18, 2012 - v1
Checksum:iB2939F3C64BD3D60
GO
Isoform 21 Publication (identifier: H3BSY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-116: RAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEE → MGGPVLGHWWHSGGMSLAVPSLPPPGKSSVFLFLQ
     401-452: EHLEAASQQN...MPSVPEDPES → VKESETSTPS...RAVLFLASCL
     453-632: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:371
Mass (Da):42,924
Checksum:i299860FD4D794543
GO
Isoform 3 (identifier: H3BSY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-262: Missing.
     401-452: EHLEAASQQN...MPSVPEDPES → VKESETSTPS...RAVLFLASCL
     453-632: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,998
Checksum:i52998CAEB94F8BB5
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8181Missing in isoform 2. 1 PublicationVSP_044751Add
BLAST
Alternative sequencei82 – 11635RAVVL…HQLEE → MGGPVLGHWWHSGGMSLAVP SLPPPGKSSVFLFLQ in isoform 2. 1 PublicationVSP_044752Add
BLAST
Alternative sequencei104 – 262159Missing in isoform 3. CuratedVSP_053442Add
BLAST
Alternative sequencei401 – 45252EHLEA…EDPES → VKESETSTPSKKGWEAGSSL WGGEVPGQRQLPAWGLVTTA PPRAVLFLASCL in isoform 2 and isoform 3. CuratedVSP_044753Add
BLAST
Alternative sequencei453 – 632180Missing in isoform 2 and isoform 3. CuratedVSP_044754Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC055876 Genomic DNA. No translation available.
CCDSiCCDS61572.1. [H3BSY2-1]
RefSeqiNP_001269397.1. NM_001282468.1. [H3BSY2-1]
UniGeneiHs.562625.
Hs.743947.

Genome annotation databases

EnsembliENST00000563027; ENSP00000456927; ENSG00000188626. [H3BSY2-1]
GeneIDi653720.
KEGGihsa:653720.
UCSCiuc021sgq.3. human. [H3BSY2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC055876 Genomic DNA. No translation available.
CCDSiCCDS61572.1. [H3BSY2-1]
RefSeqiNP_001269397.1. NM_001282468.1. [H3BSY2-1]
UniGeneiHs.562625.
Hs.743947.

3D structure databases

ProteinModelPortaliH3BSY2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000456927.

PTM databases

iPTMnetiH3BSY2.
PhosphoSiteiH3BSY2.

Proteomic databases

MaxQBiH3BSY2.
PaxDbiH3BSY2.
PRIDEiH3BSY2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000563027; ENSP00000456927; ENSG00000188626. [H3BSY2-1]
GeneIDi653720.
KEGGihsa:653720.
UCSCiuc021sgq.3. human. [H3BSY2-1]

Organism-specific databases

CTDi653720.
GeneCardsiGOLGA8M.
HGNCiHGNC:44404. GOLGA8M.
neXtProtiNX_H3BSY2.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4725. Eukaryota.
ENOG410ZIE4. LUCA.
GeneTreeiENSGT00530000062932.
HOGENOMiHOG000218631.
InParanoidiH3BSY2.
OMAiEGREAMS.
OrthoDBiEOG091G0DDT.

Miscellaneous databases

GenomeRNAii653720.
PROiH3BSY2.

Gene expression databases

BgeeiENSG00000188626.

Family and domain databases

InterProiIPR024858. Golgin_A.
[Graphical view]
PfamiPF15070. GOLGA2L5. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGOG8M_HUMAN
AccessioniPrimary (citable) accession number: H3BSY2
Secondary accession number(s): A6NCM5, F8WBD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: April 18, 2012
Last modified: September 7, 2016
This is version 36 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.