Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin-3

Gene

Ank3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments (By similarity). In skeletal muscle, required for costamere localization of DMD and betaDAG1. Regulates KCNA1 channel activity in function of dietary Mg2+ levels, and thereby contributes to the regulation of renal Mg2+ reabsorption (PubMed:23903368).By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

  • axon guidance Source: MGI
  • axonogenesis Source: BHF-UCL
  • cellular response to magnesium ion Source: UniProtKB
  • establishment of protein localization Source: MGI
  • Golgi to plasma membrane protein transport Source: MGI
  • magnesium ion homeostasis Source: UniProtKB
  • maintenance of protein location in plasma membrane Source: MGI
  • membrane assembly Source: BHF-UCL
  • mitotic cytokinesis Source: MGI
  • negative regulation of delayed rectifier potassium channel activity Source: UniProtKB
  • neuromuscular junction development Source: BHF-UCL
  • neuronal action potential Source: BHF-UCL
  • plasma membrane organization Source: MGI
  • positive regulation of action potential Source: BHF-UCL
  • positive regulation of cation channel activity Source: BHF-UCL
  • positive regulation of cell communication by electrical coupling Source: BHF-UCL
  • positive regulation of gene expression Source: BHF-UCL
  • positive regulation of homotypic cell-cell adhesion Source: BHF-UCL
  • positive regulation of membrane depolarization during cardiac muscle cell action potential Source: BHF-UCL
  • positive regulation of membrane potential Source: BHF-UCL
  • positive regulation of protein targeting to membrane Source: BHF-UCL
  • positive regulation of sodium ion transmembrane transporter activity Source: BHF-UCL
  • positive regulation of sodium ion transport Source: BHF-UCL
  • protein localization to plasma membrane Source: BHF-UCL
  • protein targeting to plasma membrane Source: BHF-UCL
  • regulation of potassium ion transport Source: BHF-UCL
  • signal transduction Source: InterPro
  • synapse organization Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-6807878. COPI-mediated anterograde transport.

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin-3
Short name:
ANK-3
Alternative name(s):
Ankyrin-G
Gene namesi
Name:Ank3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:88026. Ank3.

Subcellular locationi

GO - Cellular componenti

  • axon Source: MGI
  • axon initial segment Source: BHF-UCL
  • basal plasma membrane Source: Ensembl
  • basolateral plasma membrane Source: MGI
  • bicellular tight junction Source: Ensembl
  • cell surface Source: BHF-UCL
  • cytoplasm Source: GO_Central
  • dendrite Source: BHF-UCL
  • intercalated disc Source: MGI
  • lateral plasma membrane Source: MGI
  • lysosome Source: UniProtKB-SubCell
  • membrane Source: MGI
  • neuromuscular junction Source: BHF-UCL
  • node of Ranvier Source: BHF-UCL
  • paranode region of axon Source: MGI
  • plasma membrane Source: BHF-UCL
  • postsynaptic membrane Source: BHF-UCL
  • sarcolemma Source: BHF-UCL
  • sarcoplasmic reticulum Source: BHF-UCL
  • spectrin-associated cytoskeleton Source: BHF-UCL
  • synapse Source: MGI
  • T-tubule Source: BHF-UCL
  • Z disc Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Lysosome, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004197821 – 1961Ankyrin-3Add BLAST1961

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei22PhosphoserineBy similarity1
Modified residuei606PhosphoserineBy similarity1
Modified residuei830PhosphoserineCombined sources1
Modified residuei844PhosphoserineBy similarity1
Modified residuei850PhosphoserineCombined sources1
Modified residuei873PhosphoserineCombined sources1
Modified residuei914PhosphoserineBy similarity1
Modified residuei917PhosphoserineBy similarity1
Modified residuei923PhosphoserineCombined sources1
Modified residuei958PhosphoserineBy similarity1
Modified residuei960PhosphoserineBy similarity1
Modified residuei1114PhosphoserineCombined sources1
Modified residuei1451PhosphoserineCombined sources1
Modified residuei1462PhosphoserineCombined sources1
Modified residuei1470PhosphoserineCombined sources1
Modified residuei1473PhosphoserineCombined sources1
Modified residuei1795PhosphoserineCombined sources1
Modified residuei1813PhosphoserineBy similarity1
Modified residuei1883PhosphoserineBy similarity1
Cross-linki1923Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Isoform 6 (identifier: G5E8K5-6)
Modified residuei732PhosphoserineCombined sources1
Isoform 2 (identifier: G5E8K5-2)
Modified residuei830PhosphoserineCombined sources1
Modified residuei1560PhosphoserineCombined sources1
Isoform 3 (identifier: G5E8K5-3)
Modified residuei830PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiG5E8K5.
PaxDbiG5E8K5.
PRIDEiG5E8K5.

PTM databases

iPTMnetiG5E8K5.
PhosphoSitePlusiG5E8K5.
SwissPalmiG5E8K5.

Expressioni

Tissue specificityi

Expressed in many epithelial tissues, muscles and axons. Expressed in kidney, brain, skin, lung, liver, intestine, pancreas, heart and testis (at protein level). In testis, expressed in Leydig cells, but very weakly or not at all in Sertoli cells or seminiferous tubules. Expressed in macrophages (at protein level).3 Publications

Developmental stagei

In an in vitro model of myogenesis, not detected in proliferating myoblasts. Hardly detectable during the first days of differentiation. Expression greatly increases in mature myotubes.1 Publication

Inductioni

Up-regulated by high dietary Mg2+ levels.1 Publication

Gene expression databases

BgeeiENSMUSG00000069601.
ExpressionAtlasiG5E8K5. baseline and differential.
GenevisibleiG5E8K5. MM.

Interactioni

Subunit structurei

May be a constituent of a neurofascin/NRCAM/ankyrin G complex. Interacts with RHBG (By similarity). Directly interacts with DMD and betaDAG1; this interaction does not interfere with DMD-binding and is required for DMD and betaDAG1 retention at costameres. Interacts (via N-terminal ANK repeats) with SCHIP1 isoform 7 (via C-terminus); this interaction is required for the localization at axon initial segments (AISs) and nodes of Ranvier (NRs). Interacts with PLEC and FLNC (By similarity). Interacts with KCNA1; this inhibits channel activity (PubMed:23903368).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi198102. 1 interactor.
IntActiG5E8K5. 5 interactors.
MINTiMINT-4119418.
STRINGi10090.ENSMUSP00000090090.

Structurei

3D structure databases

ProteinModelPortaliG5E8K5.
SMRiG5E8K5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati56 – 85ANK 1Add BLAST30
Repeati89 – 118ANK 2Add BLAST30
Repeati122 – 151ANK 3Add BLAST30
Repeati155 – 184ANK 4Add BLAST30
Repeati186 – 213ANK 5Add BLAST28
Repeati217 – 246ANK 6Add BLAST30
Repeati250 – 279ANK 7Add BLAST30
Repeati283 – 312ANK 8Add BLAST30
Repeati316 – 345ANK 9Add BLAST30
Repeati349 – 378ANK 10Add BLAST30
Repeati382 – 411ANK 11Add BLAST30
Repeati415 – 444ANK 12Add BLAST30
Repeati448 – 477ANK 13Add BLAST30
Repeati481 – 510ANK 14Add BLAST30
Repeati514 – 543ANK 15Add BLAST30
Repeati547 – 576ANK 16Add BLAST30
Repeati580 – 609ANK 17Add BLAST30
Repeati613 – 642ANK 18Add BLAST30
Repeati646 – 675ANK 19Add BLAST30
Repeati679 – 708ANK 20Add BLAST30
Repeati712 – 741ANK 21Add BLAST30
Repeati745 – 774ANK 22Add BLAST30
Repeati778 – 807ANK 23Add BLAST30
Domaini983 – 1090ZU5 1PROSITE-ProRule annotationAdd BLAST108
Domaini1140 – 1259ZU5 2PROSITE-ProRule annotationAdd BLAST120
Domaini1478 – 1562DeathPROSITE-ProRule annotationAdd BLAST85

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1274 – 1408UPA domainBy similarityAdd BLAST135

Sequence similaritiesi

Contains 23 ANK repeats.PROSITE-ProRule annotation
Contains 1 death domain.PROSITE-ProRule annotation
Contains 2 ZU5 domains.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG4177. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129677.
HOGENOMiHOG000012873.
InParanoidiG5E8K5.
KOiK10380.
TreeFamiTF351263.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR000906. ZU5_dom.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 6 hits.
PF13606. Ank_3. 1 hit.
PF00531. Death. 1 hit.
PF00791. ZU5. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 22 hits.
SM00005. DEATH. 1 hit.
SM00218. ZU5. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF48403. SSF48403. 3 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 21 hits.
PS50017. DEATH_DOMAIN. 1 hit.
PS51145. ZU5. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: G5E8K5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEEPKEKPA KPAHRKRKGK KSDANASYLR AARAGHLEKA LDYIKNGVDV
60 70 80 90 100
NICNQNGLNA LHLASKEGHV EVVSELLQRE ANVDAATKKG NTALHIASLA
110 120 130 140 150
GQAEVVKVLV TNGANVNAQS QNGFTPLYMA AQENHLEVVR FLLDNGASQS
160 170 180 190 200
LATEDGFTPL AVALQQGHDQ VVSLLLENDT KGKVRLPALH IAARKDDTKA
210 220 230 240 250
AALLLQNDTN ADVESKSGFT PLHIAAHYGN INVATLLLNR AAAVDFTARN
260 270 280 290 300
DITPLHVASK RGNANMVKLL LDRGAKIDAK TRDGLTPLHC GARSGHEQVV
310 320 330 340 350
EMLLDRSAPI LSKTKNGLSP LHMATQGDHL NCVQLLLQHN VPVDDVTNDY
360 370 380 390 400
LTALHVAAHC GHYKVAKVLL DKKASPNAKA LNGFTPLHIA CKKNRIRVME
410 420 430 440 450
LLLKHGASIQ AVTESGLTPI HVAAFMGHVN IVSQLMHHGA SPNTTNVRGE
460 470 480 490 500
TALHMAARSG QAEVVRYLVQ DGAQVEAKAK DDQTPLHISA RLGKADIVQQ
510 520 530 540 550
LLQQGASPNA ATTSGYTPLH LAAREGHEDV AAFLLDHGAS LSITTKKGFT
560 570 580 590 600
PLHVAAKYGK LEVASLLLQK SASPDAAGKS GLTPLHVAAH YDNQKVALLL
610 620 630 640 650
LDQGASPHAA AKNGYTPLHI AAKKNQMDIA TSLLEYGADA NAVTRQGIAS
660 670 680 690 700
VHLAAQEGHV DMVSLLLSRN ANVNLSNKSG LTPLHLAAQE DRVNVAEVLV
710 720 730 740 750
NQGAHVDAQT KMGYTPLHVG CHYGNIKIVN FLLQHSAKVN AKTKNGYTAL
760 770 780 790 800
HQAAQQGHTH IINVLLQNNA SPNELTVNGN TALAIARRLG YISVVDTLKV
810 820 830 840 850
VTEEIMTTTT ITEKHKMNVP ETMNEVLDMS DDEVRKASAP EKLSDGEYIS
860 870 880 890 900
DGEEGDKCTW FKIPKVQEVL VKSEDAITGD TDKYLGPQDL KELGDDSLPA
910 920 930 940 950
EGYVGFSLGA RSASLRSFSS DRSYTLNRSS YARDSMMIEE LLVPSKEQHL
960 970 980 990 1000
TFTREFDSDS LRHYSWAADT LDNVNLVSSP VHSGFLVSFM VDARGGSMRG
1010 1020 1030 1040 1050
SRHHGMRIII PPRKCTAPTR ITCRLVKRHK LANPPPMVEG EGLASRLVEM
1060 1070 1080 1090 1100
GPAGAQFLGP VIVEIPHFGS MRGKERELIV LRSENGETWK EHQFDSKNED
1110 1120 1130 1140 1150
LAELLNGMDE ELDSPEELGT KRICRIITKD FPQYFAVVSR IKQESNQIGP
1160 1170 1180 1190 1200
EGGILSSTTV PLVQASFPEG ALTKRIRVGL QAQPVPEETV KKILGNKATF
1210 1220 1230 1240 1250
SPIVTVEPRR RKFHKPITMT IPVPPPSGEG VSNGYKGDAT PNLRLLCSIT
1260 1270 1280 1290 1300
GGTSPAQWED ITGTTPLTFI KDCVSFTTNV SARFWLADCH QVLETVGLAS
1310 1320 1330 1340 1350
QLYRELICVP YMAKFVVFAK TNDPVESSLR CFCMTDDRVD KTLEQQENFE
1360 1370 1380 1390 1400
EVARSKDIEV LEGKPIYVDC YGNLAPLTKG GQQLVFNFYS FKENRLPFSI
1410 1420 1430 1440 1450
KIRDTSQEPC GRLSFLKEPK TTKGLPQTAV CNLNITLPAH KKAEKADRRQ
1460 1470 1480 1490 1500
SFASLALRKR YSYLTEPSMS PQSPCERTDI RMAIVADHLG LSWTELAREL
1510 1520 1530 1540 1550
NFSVDEINQI RVENPNSLIS QSFMLLKKWV TRDGKNATTD ALTSVLTKIN
1560 1570 1580 1590 1600
RIDIVTLLEG PIFDYGNISG TRSFADENNV FHDPVDGHPS FQVELETPMG
1610 1620 1630 1640 1650
LYCTPPNPFQ QDDHFSDISS IESPFRTPSR LSDGLVPSQG NIEHPTGGPP
1660 1670 1680 1690 1700
VVTAEDTSLE DSKMDDSVTV TDPADPLDVD ESQLKDLCQS ECAQCWASVP
1710 1720 1730 1740 1750
GIPNDGRQAE PLRPQTRKVG MSSEQQEKGK SGPDEEVTED KVKSLFEDIQ
1760 1770 1780 1790 1800
LEEVEAEEMT EDQGQAMLNR VQRAELAMSS LAGWQNETPS GSLESPAQAR
1810 1820 1830 1840 1850
RLTGGLLDRL DDSSDQARDS ITSYLTGEPG KIEANGNHTA EVIPEAKAKP
1860 1870 1880 1890 1900
YFPESQNDIG KQSIKENLKP KTHGCGRTEE PVSPLTAYQK SLEETSKLVI
1910 1920 1930 1940 1950
EDAPKPCVPV GMKKMTRTTA DGKARLNLQE EEGSTRSEPK QGEGYKVKTK
1960
KEIRNVEKKT H
Length:1,961
Mass (Da):214,062
Last modified:December 14, 2011 - v1
Checksum:i58F91B5BF87867CE
GO
Isoform 2 (identifier: G5E8K5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     834-873: VRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKS → G
     1588-1783: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:1,726
Mass (Da):188,256
Checksum:i330058F77E15E49F
GO
Isoform 3 (identifier: G5E8K5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     834-873: VRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKS → G

Show »
Length:1,922
Mass (Da):209,669
Checksum:i7A4B65429B20B8F2
GO
Isoform 4 (identifier: G5E8K5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     868-872: EVLVK → MALPH

Note: No experimental confirmation available.
Show »
Length:1,094
Mass (Da):121,205
Checksum:i5D9DA021B66D5BC2
GO
Isoform 5 (identifier: G5E8K5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     868-872: EVLVK → MALPH
     1941-1941: Missing.

Show »
Length:1,093
Mass (Da):121,077
Checksum:i339712E963046146
GO
Isoform 6 (identifier: G5E8K5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     868-872: EVLVK → MALPH
     1588-1783: Missing.

Show »
Length:898
Mass (Da):99,791
Checksum:i97A7901C8A0DAD67
GO

Sequence cautioni

The sequence AAB58380 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAB58381 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti717L → P in AAH21657 (PubMed:15489334).Curated1
Sequence conflicti1603C → W in AAB01607 (PubMed:7615634).Curated1
Sequence conflicti1603C → W in AAB01603 (PubMed:7615634).Curated1
Sequence conflicti1603C → W in AAB58381 (PubMed:15489334).Curated1
Sequence conflicti1652V → I in BAC29151 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0443551 – 867Missing in isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST867
Alternative sequenceiVSP_044356834 – 873VRKAS…VLVKS → G in isoform 2 and isoform 3. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_044357868 – 872EVLVK → MALPH in isoform 4, isoform 5 and isoform 6. 2 Publications5
Alternative sequenceiVSP_0443581588 – 1783Missing in isoform 2 and isoform 6. 3 PublicationsAdd BLAST196
Alternative sequenceiVSP_0443591941Missing in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L40631 mRNA. Translation: AAB01602.1.
L40631 mRNA. Translation: AAB01603.1.
L40632 mRNA. Translation: AAB01607.1.
AK035681 mRNA. Translation: BAC29151.1.
AK162007 mRNA. Translation: BAE36677.1.
AC100427 Genomic DNA. No translation available.
AC129018 Genomic DNA. No translation available.
AC132435 Genomic DNA. No translation available.
AC156836 Genomic DNA. No translation available.
CH466553 Genomic DNA. Translation: EDL31985.1.
CH466553 Genomic DNA. Translation: EDL31989.1.
CH466553 Genomic DNA. Translation: EDL31990.1.
BC021657 mRNA. Translation: AAH21657.1.
U89274 mRNA. Translation: AAB58380.1. Different initiation.
U89275 mRNA. Translation: AAB58381.1. Different initiation.
CCDSiCCDS23909.1. [G5E8K5-1]
CCDS23912.1. [G5E8K5-4]
CCDS35931.1. [G5E8K5-3]
CCDS59545.1. [G5E8K5-2]
CCDS59546.1. [G5E8K5-6]
RefSeqiNP_033800.2. NM_009670.4. [G5E8K5-6]
NP_666117.2. NM_146005.3. [G5E8K5-1]
NP_733788.2. NM_170687.3. [G5E8K5-4]
NP_733789.1. NM_170688.2.
NP_733790.2. NM_170689.2.
NP_733791.2. NM_170690.2.
NP_733924.2. NM_170728.2. [G5E8K5-2]
NP_733925.2. NM_170729.2. [G5E8K5-3]
NP_733926.2. NM_170730.2.
XP_006513202.1. XM_006513139.3. [G5E8K5-5]
UniGeneiMm.235960.

Genome annotation databases

EnsembliENSMUST00000054167; ENSMUSP00000061698; ENSMUSG00000069601. [G5E8K5-3]
ENSMUST00000092433; ENSMUSP00000090089; ENSMUSG00000069601. [G5E8K5-4]
ENSMUST00000092434; ENSMUSP00000090090; ENSMUSG00000069601. [G5E8K5-1]
ENSMUST00000181974; ENSMUSP00000138285; ENSMUSG00000069601. [G5E8K5-6]
ENSMUST00000182029; ENSMUSP00000138337; ENSMUSG00000069601. [G5E8K5-5]
ENSMUST00000182155; ENSMUSP00000138347; ENSMUSG00000069601. [G5E8K5-2]
ENSMUST00000182884; ENSMUSP00000138326; ENSMUSG00000069601. [G5E8K5-1]
GeneIDi11735.
KEGGimmu:11735.
UCSCiuc007fmw.1. mouse. [G5E8K5-1]
uc007fna.1. mouse. [G5E8K5-2]
uc007fnb.1. mouse. [G5E8K5-3]
uc007fnh.1. mouse. [G5E8K5-6]
uc007fni.1. mouse. [G5E8K5-5]
uc007fnk.1. mouse. [G5E8K5-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L40631 mRNA. Translation: AAB01602.1.
L40631 mRNA. Translation: AAB01603.1.
L40632 mRNA. Translation: AAB01607.1.
AK035681 mRNA. Translation: BAC29151.1.
AK162007 mRNA. Translation: BAE36677.1.
AC100427 Genomic DNA. No translation available.
AC129018 Genomic DNA. No translation available.
AC132435 Genomic DNA. No translation available.
AC156836 Genomic DNA. No translation available.
CH466553 Genomic DNA. Translation: EDL31985.1.
CH466553 Genomic DNA. Translation: EDL31989.1.
CH466553 Genomic DNA. Translation: EDL31990.1.
BC021657 mRNA. Translation: AAH21657.1.
U89274 mRNA. Translation: AAB58380.1. Different initiation.
U89275 mRNA. Translation: AAB58381.1. Different initiation.
CCDSiCCDS23909.1. [G5E8K5-1]
CCDS23912.1. [G5E8K5-4]
CCDS35931.1. [G5E8K5-3]
CCDS59545.1. [G5E8K5-2]
CCDS59546.1. [G5E8K5-6]
RefSeqiNP_033800.2. NM_009670.4. [G5E8K5-6]
NP_666117.2. NM_146005.3. [G5E8K5-1]
NP_733788.2. NM_170687.3. [G5E8K5-4]
NP_733789.1. NM_170688.2.
NP_733790.2. NM_170689.2.
NP_733791.2. NM_170690.2.
NP_733924.2. NM_170728.2. [G5E8K5-2]
NP_733925.2. NM_170729.2. [G5E8K5-3]
NP_733926.2. NM_170730.2.
XP_006513202.1. XM_006513139.3. [G5E8K5-5]
UniGeneiMm.235960.

3D structure databases

ProteinModelPortaliG5E8K5.
SMRiG5E8K5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198102. 1 interactor.
IntActiG5E8K5. 5 interactors.
MINTiMINT-4119418.
STRINGi10090.ENSMUSP00000090090.

PTM databases

iPTMnetiG5E8K5.
PhosphoSitePlusiG5E8K5.
SwissPalmiG5E8K5.

Proteomic databases

MaxQBiG5E8K5.
PaxDbiG5E8K5.
PRIDEiG5E8K5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000054167; ENSMUSP00000061698; ENSMUSG00000069601. [G5E8K5-3]
ENSMUST00000092433; ENSMUSP00000090089; ENSMUSG00000069601. [G5E8K5-4]
ENSMUST00000092434; ENSMUSP00000090090; ENSMUSG00000069601. [G5E8K5-1]
ENSMUST00000181974; ENSMUSP00000138285; ENSMUSG00000069601. [G5E8K5-6]
ENSMUST00000182029; ENSMUSP00000138337; ENSMUSG00000069601. [G5E8K5-5]
ENSMUST00000182155; ENSMUSP00000138347; ENSMUSG00000069601. [G5E8K5-2]
ENSMUST00000182884; ENSMUSP00000138326; ENSMUSG00000069601. [G5E8K5-1]
GeneIDi11735.
KEGGimmu:11735.
UCSCiuc007fmw.1. mouse. [G5E8K5-1]
uc007fna.1. mouse. [G5E8K5-2]
uc007fnb.1. mouse. [G5E8K5-3]
uc007fnh.1. mouse. [G5E8K5-6]
uc007fni.1. mouse. [G5E8K5-5]
uc007fnk.1. mouse. [G5E8K5-4]

Organism-specific databases

CTDi288.
MGIiMGI:88026. Ank3.

Phylogenomic databases

eggNOGiKOG4177. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129677.
HOGENOMiHOG000012873.
InParanoidiG5E8K5.
KOiK10380.
TreeFamiTF351263.

Enzyme and pathway databases

ReactomeiR-MMU-6807878. COPI-mediated anterograde transport.

Miscellaneous databases

ChiTaRSiAnk3. mouse.
PROiG5E8K5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000069601.
ExpressionAtlasiG5E8K5. baseline and differential.
GenevisibleiG5E8K5. MM.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011029. DEATH-like_dom.
IPR000488. Death_domain.
IPR000906. ZU5_dom.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 6 hits.
PF13606. Ank_3. 1 hit.
PF00531. Death. 1 hit.
PF00791. ZU5. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 22 hits.
SM00005. DEATH. 1 hit.
SM00218. ZU5. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF48403. SSF48403. 3 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 21 hits.
PS50017. DEATH_DOMAIN. 1 hit.
PS51145. ZU5. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANK3_MOUSE
AccessioniPrimary (citable) accession number: G5E8K5
Secondary accession number(s): G5E8K4
, O08866, O08867, Q3TSJ8, Q4U205, Q4U206, Q4U256, Q4U260, Q61305, Q61306, Q61307, Q61308, Q61309, Q61310, Q8CBN3, Q8VC68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2012
Last sequence update: December 14, 2011
Last modified: November 2, 2016
This is version 50 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.