Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cortactin-binding protein 2

Gene

Cttnbp2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates the dendritic spine distribution of CTTN/cortactin in hippocampal neurons, and thus controls dendritic spinogenesis and dendritic spine maintenance.1 Publication

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Cortactin-binding protein 2
Short name:
CortBP2
Gene namesi
Name:Cttnbp2
Synonyms:Kiaa1758
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1353467. Cttnbp2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi540 – 5401P → A: Almost complete loss of CTTN-binding and loss of regulation of spine density; when associated with A-543. 1 Publication
Mutagenesisi543 – 5431P → A: Almost complete loss of CTTN-binding and loss of regulation of spine density; when associated with A-540. 1 Publication
Mutagenesisi599 – 5991P → A: Reduced CTTN-binding; when associated with A-602. 1 Publication
Mutagenesisi602 – 6021P → A: Reduced CTTN-binding; when associated with A-599. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16481648Cortactin-binding protein 2PRO_0000422172Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1510 – 15101PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiB9EJA2.
PaxDbiB9EJA2.
PeptideAtlasiB9EJA2.
PRIDEiB9EJA2.

PTM databases

iPTMnetiB9EJA2.
PhosphoSiteiB9EJA2.

Expressioni

Tissue specificityi

Isoform 2 is predominantly expressed in brain (at protein level). In the brain, expressed at high levels in hypothalamus and striatum and at lower levels in cerebellum and cortex.2 Publications

Gene expression databases

BgeeiENSMUSG00000000416.
ExpressionAtlasiB9EJA2. baseline and differential.
GenevisibleiB9EJA2. MM.

Interactioni

Subunit structurei

Interacts with CTTN/cortactin SH3 domain. Interacts with STRN, STRN4/zinedin and MOB4/phocein; this interaction may regulate dendritic spine distribution of STRN and STRN4 in hippocampal neurons (By similarity). Activation of glutamate receptors weakens the interaction with STRN and STRN4 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000088089.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati699 – 72931ANK 1Add
BLAST
Repeati733 – 76230ANK 2Add
BLAST
Repeati766 – 79530ANK 3Add
BLAST
Repeati799 – 82830ANK 4Add
BLAST
Repeati832 – 86130ANK 5Add
BLAST
Repeati901 – 93131ANK 6Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili119 – 274156Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 6 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IGN3. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00680000099614.
HOGENOMiHOG000112055.
HOVERGENiHBG073485.
InParanoidiB9EJA2.
OMAiKHRQMAA.
OrthoDBiEOG091G0CSA.
TreeFamiTF325130.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR019131. Cortactin-binding_p2_N.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF09727. CortBP2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 2 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B9EJA2-1) [UniParc]FASTAAdd to basket
Also known as: CTTNBP2-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATDSASCEP DLSRTPGDTE GATAEAAKKE FDVDTLSKSE LRMLLSVMEG
60 70 80 90 100
ELEARDLVIE ALRARRKEVF IQERYGRFNL NDPFLALQRD YEAGPGDKEK
110 120 130 140 150
PVCTNPLSIL EAVMAHCRKM QERMSAQLVA AESRQKKLEM EKLQLQALEQ
160 170 180 190 200
EHKKLAAHLE EERGKNKHVV LMLVKECKQL SGKVVEEAQK LEEVMAQLEE
210 220 230 240 250
EKKKTSELEE QLSAEKQRSS GMEAQLEKQL SEFDTEREQL RAKLSREEAH
260 270 280 290 300
TTDLKEEIDK MKKMMEQMKK GSDGKPGLSL PRKTKDKRLA SISVATEGPV
310 320 330 340 350
TRSVACQTDV VTESTDPVKK LPLTVPIKPS TGSPLVPTNT KGNVGPSALL
360 370 380 390 400
IRPGIDRQSS HSDLGPSPPT ALPSSANRIE ENGPSTGNAP DLSNSTPSTP
410 420 430 440 450
SSTAPAAAQT PGTAPQNHSQ APTVHSLHSP CANTHPGLNP RIQAARFRFQ
460 470 480 490 500
GNANDPDQNG NNTQSPPSRD VSPTSRDNLV AKQLARNTVT QALSRFTSPQ
510 520 530 540 550
AGASSRLGVS PGGDAGTCPP VGRTGLKTPG AARVDRGNPP PIPPKKPGLS
560 570 580 590 600
QTPSPPHPQL RASNAGAKVD NKIVASPPST LPQGTKVVNE ENVPKSSSPQ
610 620 630 640 650
LPPKPSIDLT VAPAGCPVSA LATSQVGAWP AGTPGLNQPA CSDSSLVIPA
660 670 680 690 700
TVAFCSSINP VSASSRSPGA SDSLLVAASG WSPSLTPLLM SGGPAPLAGR
710 720 730 740 750
PTLLQQAAAQ GNVTLLSMLL NEEGLDINYS CEDGHSALYS AAKNGHTDCV
760 770 780 790 800
RLLLNAEARV DAADKNGFTP LCVAAAQGHF ECIELLTAYN ANINHSAAGG
810 820 830 840 850
QTPLYLACKN GNKECIKLLL EAGTDRSIKT RDGWTPIHAA VDTGNVDSLK
860 870 880 890 900
LLMYHRVRAH GNSLSSEEPK SGLFSLNGGE SPTGPSKPVV PADLINHADK
910 920 930 940 950
EGWTAAHIAA SKGFKNCLEV LCRHGGLEPE RRDKCNRTVH DVATDDCKHL
960 970 980 990 1000
LENLNALKIP LRISVGEIQP SNDVSDDFEC EHTICTLNIR KQTSWEDFSK
1010 1020 1030 1040 1050
AVSQALTNHF QAISSDGWWS LEDGTFNNAT DSCIGLGTSS IRSIMLGSMP
1060 1070 1080 1090 1100
WSTGQSFSQS PWDFLKKKKV EQVLALLSGP QEGCLSSVTY ASMIPLQMLQ
1110 1120 1130 1140 1150
NYLRLVEQYH NVIFHGPEGS LQDYIANQLA LCMKYRQMAA GFPCEIVRAE
1160 1170 1180 1190 1200
VDSGFSKEQL VDVFIRNACL IPVKQFPVKK KIIVILENLE KSSLSELLGD
1210 1220 1230 1240 1250
FLAPLENRST ESPCTFQKGN GTSECYYFHE NCFLVGTIAK ACLQGSDLLV
1260 1270 1280 1290 1300
QQHFRWVQLR WDCEPIQGLL QRFLRRKVVS KFRGQLPAPC DPVCKIVDWA
1310 1320 1330 1340 1350
LSVWRQLNSC LARLGTPEAL LGPKYFLSCP VVPGHAQATV KWMSKLWNAV
1360 1370 1380 1390 1400
IAPRVQEAIL SRASMNKQPG TGQTASKKYP SQGQQAVVRA ALSILLNKAV
1410 1420 1430 1440 1450
LHGCPLPRAE LDQQIADFKG GSFPLSIVSS YSKKKVESGA WRKVNTSPRK
1460 1470 1480 1490 1500
KPGHFSSPTW NKPDPKREGM RNKTIPHLNT NRNSSLSKQQ SLENDLSVTL
1510 1520 1530 1540 1550
TLDHRLSLGS DDEADLVKEL QSMCSSKSES DISKIADSRD DLRKFDSSRT
1560 1570 1580 1590 1600
NPGTSAPLNL RTPVPQKEAS PPSSRQTAEC SNSKSKTEMG VSSVKSFLPV
1610 1620 1630 1640
PRSKVAQCSQ NTKRNSSSSN TRQLEINNNS KEENWTLDKH EQVEKPNK
Length:1,648
Mass (Da):178,774
Last modified:May 1, 2013 - v2
Checksum:i7C7016DB9E61D7E0
GO
Isoform 2 (identifier: B9EJA2-2) [UniParc]FASTAAdd to basket
Also known as: CTTNBP2-S

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: VGAWP → AGHPP
     631-1648: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:630
Mass (Da):67,549
Checksum:iDAB904B4C2086805
GO
Isoform 3 (identifier: B9EJA2-3) [UniParc]FASTAAdd to basket
Also known as: CTTNBP2-intron

The sequence of this isoform differs from the canonical sequence as follows:
     681-710: WSPSLTPLLMSGGPAPLAGRPTLLQQAAAQ → KGIEVFYPFVKNVPYSLTSLNFFYVVLKRF
     711-1648: Missing.

Note: Due to intron retention.
Show »
Length:710
Mass (Da):75,900
Checksum:i9418424395611C6B
GO
Isoform 4 (identifier: B9EJA2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1568-1648: EASPPSSRQT...KHEQVEKPNK → KQSRSVFPEH...IGLPTPPTTT

Note: May be due to competing acceptor splice site. No experimental confirmation available.
Show »
Length:1,623
Mass (Da):176,483
Checksum:i098F1010FBE909F1
GO
Isoform 5 (identifier: B9EJA2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-680: VGAWPAGTPGLNQPACSDSSLVIPATVAFCSSINPVSASSRSPGASDSLLVAASG → KIQKVKCTREEPSC

Note: No experimental confirmation available.
Show »
Length:1,607
Mass (Da):175,193
Checksum:iF1CDBDB0188294FB
GO

Sequence cautioni

The sequence BAD32532 differs from that shown.Erroneous CDS prediction and frameshift.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti521 – 5211V → F in AK028980 (PubMed:16141072).Curated
Sequence conflicti661 – 6611V → F in AK028980 (PubMed:16141072).Curated
Sequence conflicti1619 – 16191S → SSS in AAI41408 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei626 – 68055VGAWP…VAASG → KIQKVKCTREEPSC in isoform 5. 1 PublicationVSP_046473Add
BLAST
Alternative sequencei626 – 6305VGAWP → AGHPP in isoform 2. 1 PublicationVSP_046474
Alternative sequencei631 – 16481018Missing in isoform 2. 1 PublicationVSP_046475Add
BLAST
Alternative sequencei681 – 71030WSPSL…QAAAQ → KGIEVFYPFVKNVPYSLTSL NFFYVVLKRF in isoform 3. 1 PublicationVSP_046476Add
BLAST
Alternative sequencei711 – 1648938Missing in isoform 3. 1 PublicationVSP_046477Add
BLAST
Alternative sequencei1568 – 164881EASPP…EKPNK → KQSRSVFPEHQKKQQQQQYK ATRNQQQLQRRELDLRQTRT SRKTKQIGLPTPPTTT in isoform 4. 1 PublicationVSP_046478Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028980 mRNA. No translation available.
AK032356 mRNA. Translation: BAC27832.1.
AK078315 mRNA. Translation: BAC37216.1.
AC027654 Genomic DNA. No translation available.
AC158663 Genomic DNA. No translation available.
CH466533 Genomic DNA. Translation: EDL13863.1.
BC068156 mRNA. No translation available.
BQ769661 mRNA. No translation available.
BC141407 mRNA. Translation: AAI41408.1.
CB526439 mRNA. No translation available.
AK173254 mRNA. Translation: BAD32532.1. Sequence problems.
CCDSiCCDS39432.1. [B9EJA2-1]
RefSeqiNP_525024.1. NM_080285.1. [B9EJA2-1]
XP_006505167.1. XM_006505104.1. [B9EJA2-5]
UniGeneiMm.224189.

Genome annotation databases

EnsembliENSMUST00000090601; ENSMUSP00000088089; ENSMUSG00000000416. [B9EJA2-1]
ENSMUST00000148602; ENSMUSP00000118432; ENSMUSG00000000416. [B9EJA2-2]
GeneIDi30785.
KEGGimmu:30785.
UCSCiuc009bak.1. mouse. [B9EJA2-1]
uc009ban.1. mouse. [B9EJA2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028980 mRNA. No translation available.
AK032356 mRNA. Translation: BAC27832.1.
AK078315 mRNA. Translation: BAC37216.1.
AC027654 Genomic DNA. No translation available.
AC158663 Genomic DNA. No translation available.
CH466533 Genomic DNA. Translation: EDL13863.1.
BC068156 mRNA. No translation available.
BQ769661 mRNA. No translation available.
BC141407 mRNA. Translation: AAI41408.1.
CB526439 mRNA. No translation available.
AK173254 mRNA. Translation: BAD32532.1. Sequence problems.
CCDSiCCDS39432.1. [B9EJA2-1]
RefSeqiNP_525024.1. NM_080285.1. [B9EJA2-1]
XP_006505167.1. XM_006505104.1. [B9EJA2-5]
UniGeneiMm.224189.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000088089.

PTM databases

iPTMnetiB9EJA2.
PhosphoSiteiB9EJA2.

Proteomic databases

MaxQBiB9EJA2.
PaxDbiB9EJA2.
PeptideAtlasiB9EJA2.
PRIDEiB9EJA2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000090601; ENSMUSP00000088089; ENSMUSG00000000416. [B9EJA2-1]
ENSMUST00000148602; ENSMUSP00000118432; ENSMUSG00000000416. [B9EJA2-2]
GeneIDi30785.
KEGGimmu:30785.
UCSCiuc009bak.1. mouse. [B9EJA2-1]
uc009ban.1. mouse. [B9EJA2-3]

Organism-specific databases

CTDi83992.
MGIiMGI:1353467. Cttnbp2.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IGN3. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00680000099614.
HOGENOMiHOG000112055.
HOVERGENiHBG073485.
InParanoidiB9EJA2.
OMAiKHRQMAA.
OrthoDBiEOG091G0CSA.
TreeFamiTF325130.

Miscellaneous databases

ChiTaRSiCttnbp2. mouse.
PROiB9EJA2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000000416.
ExpressionAtlasiB9EJA2. baseline and differential.
GenevisibleiB9EJA2. MM.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR019131. Cortactin-binding_p2_N.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF09727. CortBP2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 2 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCTTB2_MOUSE
AccessioniPrimary (citable) accession number: B9EJA2
Secondary accession number(s): G3X9L7
, Q69ZB2, Q8BVG1, Q8C044
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2013
Last sequence update: May 1, 2013
Last modified: September 7, 2016
This is version 57 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.