Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Xaa-Pro aminopeptidase 3

Gene

Xpnpep3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Leu-Pro-Ala. Also shows low activity towards peptides with Ala or Ser at the P1 position. Promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, suggesting a function as an adapter protein for TNFRSF1B; the effect is independent of XPNPEP3 peptidase activity. May inhibit apoptotic cell death induced via TNF-TNFRSF1B signaling.By similarity

Catalytic activityi

Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.By similarity

Cofactori

Mn2+By similarityNote: Binds 2 manganese ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei300SubstrateBy similarity1
Metal bindingi331Manganese 2By similarity1
Binding sitei331SubstrateBy similarity1
Metal bindingi342Manganese 1By similarity1
Metal bindingi342Manganese 2By similarity1
Binding sitei342SubstrateBy similarity1
Metal bindingi423Manganese 1By similarity1
Binding sitei423SubstrateBy similarity1
Binding sitei430SubstrateBy similarity1
Metal bindingi450Manganese 1By similarity1
Binding sitei450SubstrateBy similarity1
Metal bindingi474Manganese 1By similarity1
Metal bindingi474Manganese 2By similarity1
Binding sitei474SubstrateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandManganese, Metal-binding

Protein family/group databases

MEROPSiM24.026

Names & Taxonomyi

Protein namesi
Recommended name:
Xaa-Pro aminopeptidase 3Imported (EC:3.4.11.9)
Short name:
X-Pro aminopeptidase 3
Alternative name(s):
Aminopeptidase P3
Short name:
APP3
Gene namesi
Name:Xpnpep3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2445217 Xpnpep3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 31MitochondrionSequence analysisAdd BLAST31
ChainiPRO_000040120832 – 506Xaa-Pro aminopeptidase 3Add BLAST475

Proteomic databases

EPDiB7ZMP1
MaxQBiB7ZMP1
PaxDbiB7ZMP1
PeptideAtlasiB7ZMP1
PRIDEiB7ZMP1

PTM databases

iPTMnetiB7ZMP1
PhosphoSitePlusiB7ZMP1

Expressioni

Tissue specificityi

Expressed in brain, kidney, heart, liver, skeletal muscle and testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000022401
ExpressionAtlasiB7ZMP1 baseline and differential
GenevisibleiB7ZMP1 MM

Interactioni

Subunit structurei

Homodimer. Interacts with TNFRSF1B/TNFR2 (activated) and TRAF2.By similarity

Protein-protein interaction databases

IntActiB7ZMP1, 1 interactor
MINTiB7ZMP1
STRINGi10090.ENSMUSP00000038331

Structurei

3D structure databases

ProteinModelPortaliB7ZMP1
SMRiB7ZMP1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni54 – 79Interaction with TNFRSF1BBy similarityAdd BLAST26

Sequence similaritiesi

Belongs to the peptidase M24B family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG2414 Eukaryota
COG0006 LUCA
GeneTreeiENSGT00550000074909
HOGENOMiHOG000008762
HOVERGENiHBG057305
InParanoidiB7ZMP1
KOiK01262
OMAiKKYFMHG
OrthoDBiEOG091G09J7
TreeFamiTF314484

Family and domain databases

Gene3Di3.40.350.10, 1 hit
InterProiView protein in InterPro
IPR007865 Aminopep_P_N
IPR029149 Creatin/AminoP/Spt16_NTD
IPR036005 Creatinase/aminopeptidase-like
IPR000994 Pept_M24
PfamiView protein in Pfam
PF05195 AMP_N, 1 hit
PF00557 Peptidase_M24, 1 hit
SMARTiView protein in SMART
SM01011 AMP_N, 1 hit
SUPFAMiSSF53092 SSF53092, 1 hit
SSF55920 SSF55920, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B7ZMP1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSLLSTPKL APVLARLRGL SGCMSCLQRR YSLQPAPVKK IPNRYLGQPS
60 70 80 90 100
PVTHPHLLRP GEVTPGLSQV EYALRRHKLM ALVHKEAQGH SGTDHTVVVL
110 120 130 140 150
SNPTYYMSND IPYTFHQDNN FLYLCGFQEP DSILVLQSFS GKQLPSHKAM
160 170 180 190 200
LFVPRRDPGR ELWDGPRSGT DGAIALTGVD EAYPLEEFQH LLPKLRAETN
210 220 230 240 250
MVWYDWMKPS HAQLHSDYMQ PLTEAKARSK NKVRSVQQLI QRLRLVKSPS
260 270 280 290 300
EIKRMQIAGK LTSEAFIETM FASKAPIDEA FLYAKFEFEC RARGADILAY
310 320 330 340 350
PPVVAGGNRS NTLHYVKNNQ LIKDGEMVLL DGGCESSCYV SDITRTWPVN
360 370 380 390 400
GRFTAPQAEL YEAVLEIQRA CLTLCSPGTS LENIYSMMLT LIGQKLKDLG
410 420 430 440 450
ITKTSKESAF KAARKYCPHH VGHYLGMDVH DTPDMPRSLP LQPGMVITVE
460 470 480 490 500
PGIYIPEDDR DAPEKFRGLG VRIEDDVVVT QDSPLILSAD CPKEMNDIEQ

ICSRTS
Length:506
Mass (Da):56,677
Last modified:March 3, 2009 - v1
Checksum:iE1F36BDA1F92C023
GO
Isoform 2 (identifier: B7ZMP1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: FTAPQAELYEAVLEIQRACLTLCSPGTSLENIYS → LLENTALIMLAITSGWMSMTLQTCLGHSLCSLEW
     387-506: Missing.

Note: No experimental confirmation available.
Show »
Length:386
Mass (Da):43,367
Checksum:iCD47003E01441698
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040145353 – 386FTAPQ…ENIYS → LLENTALIMLAITSGWMSMT LQTCLGHSLCSLEW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_040146387 – 506Missing in isoform 2. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK088324 mRNA Translation: BAC40282.1
CH466550 Genomic DNA Translation: EDL04573.1
CH466550 Genomic DNA Translation: EDL04574.1
BC137569 mRNA Translation: AAI37570.1
BC144717 mRNA Translation: AAI44718.1
CCDSiCCDS27668.1 [B7ZMP1-2]
CCDS84182.1 [B7ZMP1-1]
RefSeqiNP_001334004.1, NM_001347075.1 [B7ZMP1-1]
NP_796284.1, NM_177310.2 [B7ZMP1-2]
UniGeneiMm.390833

Genome annotation databases

EnsembliENSMUST00000041609; ENSMUSP00000038331; ENSMUSG00000022401 [B7ZMP1-2]
ENSMUST00000163754; ENSMUSP00000132822; ENSMUSG00000022401 [B7ZMP1-1]
GeneIDi321003
KEGGimmu:321003
UCSCiuc007wwo.1 mouse [B7ZMP1-2]
uc011zwj.1 mouse [B7ZMP1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiXPP3_MOUSE
AccessioniPrimary (citable) accession number: B7ZMP1
Secondary accession number(s): Q8BHT9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 30, 2010
Last sequence update: March 3, 2009
Last modified: May 23, 2018
This is version 71 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health