B7ZMP1 (XPP3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 33.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable Xaa-Pro aminopeptidase 3 Short name=X-Pro aminopeptidase 3 EC=3.4.11.9 Alternative name(s): Aminopeptidase P3 Short name=APP3 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 506 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide. |
| Cofactor | Binds 2 manganese ions per subunit By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed in brain, kidney, heart, liver, skeletal muscle and testis. Ref.4 |
| Sequence similarities | Belongs to the peptidase M24B family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Ligand | Manganese Metal-binding |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular process Inferred from electronic annotation. Source: InterPro glomerular filtrationInferred from electronic annotation. Source: Compara protein processingInferred from electronic annotation. Source: Compara |
| Cellular_component | mitochondrion Inferred from direct assay PubMed 14651853PubMed 18614015Ref.4. Source: MGI |
| Molecular_function | aminopeptidase activity Inferred from electronic annotation. Source: InterPro manganese ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: B7ZMP1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: B7ZMP1-2) The sequence of this isoform differs from the canonical sequence as follows: 353-386: FTAPQAELYEAVLEIQRACLTLCSPGTSLENIYS → LLENTALIMLAITSGWMSMTLQTCLGHSLCSLEW 387-506: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 506 | 506 | Probable Xaa-Pro aminopeptidase 3 | PRO_0000401208 | |||||
Sites | |||||||||
| Metal binding | 331 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 342 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 342 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 423 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 450 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 474 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 474 | 1 | Manganese 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 353 – 386 | 34 | FTAPQ…ENIYS → LLENTALIMLAITSGWMSMT LQTCLGHSLCSLEW in isoform 2. | VSP_040145 | |||||
| Alternative sequence | 387 – 506 | 120 | Missing in isoform 2. | VSP_040146 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK088324 mRNA. Translation: BAC40282.1. CH466550 Genomic DNA. Translation: EDL04573.1. CH466550 Genomic DNA. Translation: EDL04574.1. BC137569 mRNA. Translation: AAI37570.1. BC144717 mRNA. Translation: AAI44718.1. |
| IPI | IPI00221972. IPI00923106. |
| RefSeq | NP_796284.1. NM_177310.2. |
| UniGene | Mm.390833. |
3D structure databases | |
| ProteinModelPortal | B7ZMP1. |
| SMR | B7ZMP1. Positions 72-499. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-4110631. |
| STRING | 10090.ENSMUSP00000038331. |
Protein family/group databases | |
| MEROPS | M24.026. |
Proteomic databases | |
| PaxDb | B7ZMP1. |
| PRIDE | B7ZMP1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000041609; ENSMUSP00000038331; ENSMUSG00000022401. ENSMUST00000163754; ENSMUSP00000132822; ENSMUSG00000022401. |
| GeneID | 321003. |
| KEGG | mmu:321003. |
| UCSC | uc007wwo.1. mouse. uc011zwj.1. mouse. |
Organism-specific databases | |
| CTD | 63929. |
| MGI | MGI:2445217. Xpnpep3. |
Phylogenomic databases | |
| eggNOG | COG0006. |
| GeneTree | ENSGT00550000074909. |
| HOGENOM | HOG000008762. |
| HOVERGEN | HBG057305. |
| InParanoid | Q8BHT9. |
| KO | K01262. |
| OMA | KEVKHIE. |
| OrthoDB | EOG4KPT9J. |
Gene expression databases | |
| ArrayExpress | B7ZMP1. |
| Bgee | B7ZMP1. |
| Genevestigator | B7ZMP1. |
Family and domain databases | |
| Gene3D | 3.90.230.10. 1 hit. |
| InterPro | IPR007865. Aminopep_P_N. IPR000994. Pept_M24_structural-domain. [Graphical view] |
| Pfam | PF05195. AMP_N. 1 hit. PF00557. Peptidase_M24. 1 hit. [Graphical view] |
| SMART | SM01011. AMP_N. 1 hit. [Graphical view] |
| SUPFAM | SSF55920. Peptidase_M24_cat_core. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 397845. |
| SOURCE | Search... |
Entry information
| Entry name | XPP3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: B7ZMP1 Secondary accession number(s): Q8BHT9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
