Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable Xaa-Pro aminopeptidase 3

Gene

Xpnpep3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.

Cofactori

Mn2+By similarityNote: Binds 2 manganese ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi331Manganese 2By similarity1
Metal bindingi342Manganese 1By similarity1
Metal bindingi342Manganese 2By similarity1
Metal bindingi423Manganese 1By similarity1
Metal bindingi450Manganese 1By similarity1
Metal bindingi474Manganese 1By similarity1
Metal bindingi474Manganese 2By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Manganese, Metal-binding

Protein family/group databases

MEROPSiM24.026.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable Xaa-Pro aminopeptidase 3 (EC:3.4.11.9)
Short name:
X-Pro aminopeptidase 3
Alternative name(s):
Aminopeptidase P3
Short name:
APP3
Gene namesi
Name:Xpnpep3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2445217. Xpnpep3.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: Ensembl
  • mitochondrion Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004012081 – 506Probable Xaa-Pro aminopeptidase 3Add BLAST506

Proteomic databases

EPDiB7ZMP1.
MaxQBiB7ZMP1.
PaxDbiB7ZMP1.
PeptideAtlasiB7ZMP1.
PRIDEiB7ZMP1.

PTM databases

iPTMnetiB7ZMP1.
PhosphoSitePlusiB7ZMP1.

Expressioni

Tissue specificityi

Expressed in brain, kidney, heart, liver, skeletal muscle and testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000022401.
ExpressionAtlasiB7ZMP1. baseline and differential.
GenevisibleiB7ZMP1. MM.

Interactioni

Protein-protein interaction databases

BioGridi236455. 1 interactor.
IntActiB7ZMP1. 1 interactor.
MINTiMINT-4110631.
STRINGi10090.ENSMUSP00000038331.

Structurei

3D structure databases

ProteinModelPortaliB7ZMP1.
SMRiB7ZMP1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M24B family.Curated

Phylogenomic databases

eggNOGiKOG2414. Eukaryota.
COG0006. LUCA.
GeneTreeiENSGT00550000074909.
HOGENOMiHOG000008762.
HOVERGENiHBG057305.
InParanoidiB7ZMP1.
KOiK01262.
OMAiCILHYQQ.
OrthoDBiEOG091G09J7.
TreeFamiTF314484.

Family and domain databases

Gene3Di3.40.350.10. 1 hit.
3.90.230.10. 1 hit.
InterProiIPR007865. Aminopep_P_N.
IPR029149. Creatin/AminoP/Spt16_NTD.
IPR028980. Creatinase/Aminopeptidase_P_N.
IPR000994. Pept_M24.
[Graphical view]
PfamiPF05195. AMP_N. 1 hit.
PF00557. Peptidase_M24. 1 hit.
[Graphical view]
SMARTiSM01011. AMP_N. 1 hit.
[Graphical view]
SUPFAMiSSF53092. SSF53092. 1 hit.
SSF55920. SSF55920. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B7ZMP1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSLLSTPKL APVLARLRGL SGCMSCLQRR YSLQPAPVKK IPNRYLGQPS
60 70 80 90 100
PVTHPHLLRP GEVTPGLSQV EYALRRHKLM ALVHKEAQGH SGTDHTVVVL
110 120 130 140 150
SNPTYYMSND IPYTFHQDNN FLYLCGFQEP DSILVLQSFS GKQLPSHKAM
160 170 180 190 200
LFVPRRDPGR ELWDGPRSGT DGAIALTGVD EAYPLEEFQH LLPKLRAETN
210 220 230 240 250
MVWYDWMKPS HAQLHSDYMQ PLTEAKARSK NKVRSVQQLI QRLRLVKSPS
260 270 280 290 300
EIKRMQIAGK LTSEAFIETM FASKAPIDEA FLYAKFEFEC RARGADILAY
310 320 330 340 350
PPVVAGGNRS NTLHYVKNNQ LIKDGEMVLL DGGCESSCYV SDITRTWPVN
360 370 380 390 400
GRFTAPQAEL YEAVLEIQRA CLTLCSPGTS LENIYSMMLT LIGQKLKDLG
410 420 430 440 450
ITKTSKESAF KAARKYCPHH VGHYLGMDVH DTPDMPRSLP LQPGMVITVE
460 470 480 490 500
PGIYIPEDDR DAPEKFRGLG VRIEDDVVVT QDSPLILSAD CPKEMNDIEQ

ICSRTS
Length:506
Mass (Da):56,677
Last modified:March 3, 2009 - v1
Checksum:iE1F36BDA1F92C023
GO
Isoform 2 (identifier: B7ZMP1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: FTAPQAELYEAVLEIQRACLTLCSPGTSLENIYS → LLENTALIMLAITSGWMSMTLQTCLGHSLCSLEW
     387-506: Missing.

Note: No experimental confirmation available.
Show »
Length:386
Mass (Da):43,367
Checksum:iCD47003E01441698
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040145353 – 386FTAPQ…ENIYS → LLENTALIMLAITSGWMSMT LQTCLGHSLCSLEW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_040146387 – 506Missing in isoform 2. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK088324 mRNA. Translation: BAC40282.1.
CH466550 Genomic DNA. Translation: EDL04573.1.
CH466550 Genomic DNA. Translation: EDL04574.1.
BC137569 mRNA. Translation: AAI37570.1.
BC144717 mRNA. Translation: AAI44718.1.
CCDSiCCDS27668.1. [B7ZMP1-2]
RefSeqiNP_796284.1. NM_177310.2. [B7ZMP1-2]
XP_006521149.1. XM_006521086.3. [B7ZMP1-1]
UniGeneiMm.390833.

Genome annotation databases

EnsembliENSMUST00000041609; ENSMUSP00000038331; ENSMUSG00000022401. [B7ZMP1-2]
ENSMUST00000163754; ENSMUSP00000132822; ENSMUSG00000022401. [B7ZMP1-1]
GeneIDi321003.
KEGGimmu:321003.
UCSCiuc007wwo.1. mouse. [B7ZMP1-2]
uc011zwj.1. mouse. [B7ZMP1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK088324 mRNA. Translation: BAC40282.1.
CH466550 Genomic DNA. Translation: EDL04573.1.
CH466550 Genomic DNA. Translation: EDL04574.1.
BC137569 mRNA. Translation: AAI37570.1.
BC144717 mRNA. Translation: AAI44718.1.
CCDSiCCDS27668.1. [B7ZMP1-2]
RefSeqiNP_796284.1. NM_177310.2. [B7ZMP1-2]
XP_006521149.1. XM_006521086.3. [B7ZMP1-1]
UniGeneiMm.390833.

3D structure databases

ProteinModelPortaliB7ZMP1.
SMRiB7ZMP1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi236455. 1 interactor.
IntActiB7ZMP1. 1 interactor.
MINTiMINT-4110631.
STRINGi10090.ENSMUSP00000038331.

Protein family/group databases

MEROPSiM24.026.

PTM databases

iPTMnetiB7ZMP1.
PhosphoSitePlusiB7ZMP1.

Proteomic databases

EPDiB7ZMP1.
MaxQBiB7ZMP1.
PaxDbiB7ZMP1.
PeptideAtlasiB7ZMP1.
PRIDEiB7ZMP1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041609; ENSMUSP00000038331; ENSMUSG00000022401. [B7ZMP1-2]
ENSMUST00000163754; ENSMUSP00000132822; ENSMUSG00000022401. [B7ZMP1-1]
GeneIDi321003.
KEGGimmu:321003.
UCSCiuc007wwo.1. mouse. [B7ZMP1-2]
uc011zwj.1. mouse. [B7ZMP1-1]

Organism-specific databases

CTDi63929.
MGIiMGI:2445217. Xpnpep3.

Phylogenomic databases

eggNOGiKOG2414. Eukaryota.
COG0006. LUCA.
GeneTreeiENSGT00550000074909.
HOGENOMiHOG000008762.
HOVERGENiHBG057305.
InParanoidiB7ZMP1.
KOiK01262.
OMAiCILHYQQ.
OrthoDBiEOG091G09J7.
TreeFamiTF314484.

Miscellaneous databases

PROiB7ZMP1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022401.
ExpressionAtlasiB7ZMP1. baseline and differential.
GenevisibleiB7ZMP1. MM.

Family and domain databases

Gene3Di3.40.350.10. 1 hit.
3.90.230.10. 1 hit.
InterProiIPR007865. Aminopep_P_N.
IPR029149. Creatin/AminoP/Spt16_NTD.
IPR028980. Creatinase/Aminopeptidase_P_N.
IPR000994. Pept_M24.
[Graphical view]
PfamiPF05195. AMP_N. 1 hit.
PF00557. Peptidase_M24. 1 hit.
[Graphical view]
SMARTiSM01011. AMP_N. 1 hit.
[Graphical view]
SUPFAMiSSF53092. SSF53092. 1 hit.
SSF55920. SSF55920. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiXPP3_MOUSE
AccessioniPrimary (citable) accession number: B7ZMP1
Secondary accession number(s): Q8BHT9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 30, 2010
Last sequence update: March 3, 2009
Last modified: November 30, 2016
This is version 63 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.