Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein shisa-9

Gene

SHISA9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regulator of short-term neuronal synaptic plasticity in the dentate gyrus. Associates with AMPA receptors (ionotropic glutamate receptors) in synaptic spines and promotes AMPA receptor desensitization at excitatory synapses (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein shisa-9
Gene namesi
Name:SHISA9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:37231. SHISA9.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 149126ExtracellularSequence analysisAdd
BLAST
Transmembranei150 – 17021HelicalSequence analysisAdd
BLAST
Topological domaini171 – 424254CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165450677.

Polymorphism and mutation databases

BioMutaiSHISA9.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence analysisAdd
BLAST
Chaini24 – 424401Protein shisa-9PRO_0000392536Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi45 – 451N-linked (GlcNAc...)Sequence analysis
Glycosylationi89 – 891N-linked (GlcNAc...)Sequence analysis
Glycosylationi116 – 1161N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiB4DS77.
PaxDbiB4DS77.
PeptideAtlasiB4DS77.
PRIDEiB4DS77.

PTM databases

iPTMnetiB4DS77.
PhosphoSiteiB4DS77.

Expressioni

Gene expression databases

BgeeiB4DS77.
GenevisibleiB4DS77. HS.

Organism-specific databases

HPAiHPA053177.

Interactioni

Subunit structurei

Component of some AMPA receptors (ionotropic glutamate receptors) complex, at least composed of some AMPA receptor (GRIA1, GRIA2 and/or GRIA3), CACNG2 and SHISA9, as well as low level of DLG4.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000454014.

Structurei

3D structure databases

ProteinModelPortaliB4DS77.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the shisa family. SHISA9 subfamily.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IK0B. Eukaryota.
ENOG410YB4B. LUCA.
GeneTreeiENSGT00510000047247.
HOGENOMiHOG000169786.
HOVERGENiHBG055090.
InParanoidiB4DS77.
OMAiGSYLYCC.
OrthoDBiEOG7N0C56.
PhylomeDBiB4DS77.

Family and domain databases

InterProiIPR026910. Shisa.
[Graphical view]
PfamiPF13908. Shisa. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B4DS77-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRVLRLLLG CFLTELCARV CRAQERAGHG QLAQLGGVLL LAGGNRSGAA
60 70 80 90 100
SGEASEGAEA SDAPPTRAPT PDFCRGYFDV MGQWDPPFNC SSGDFIFCCG
110 120 130 140 150
TCGFRFCCTF KKRRLNQSTC TNYDTPLWLN TGKPPARKDD PLHDPTKDKT
160 170 180 190 200
NLIVYIICGV VAVMVLVGIF TKLGLEKAHR PQREHMSRAL ADVMRPQGHC
210 220 230 240 250
NTDHMERDLN IVVHVQHYEN MDTRTPINNL HATQMNNAVP TSPLLQQMGH
260 270 280 290 300
PHSYPNLGQI SNPYEQQPPG KELNKYASLK AVGSSDGDWA VSTLKSPKAD
310 320 330 340 350
KVNDDFYTKR RHLAELAAKG NLPLHPVRVE DEPRAFSPEH GPAKQNGQKS
360 370 380 390 400
RTNKMPPHPL AYTSTTNFKG WDPNEQSLRR QAYSNKGKLG TAETGSSDPL
410 420
GTRPQHYPPP QPYFITNSKT EVTV
Note: No experimental confirmation available.
Length:424
Mass (Da):46,925
Last modified:May 18, 2010 - v3
Checksum:i600FBCEB2846F615
GO
Isoform 2 (identifier: B4DS77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Note: No experimental confirmation available.
Show »
Length:344
Mass (Da):38,583
Checksum:i9D78F0D6CB93DC88
GO
Isoform 3 (identifier: B4DS77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-221: ALADVMRPQGHCNTDHMERDLNIVVHVQHYENM → LYDNLLFMEAQISFQEDEPAPGEWSVGLQTWTV
     222-424: Missing.

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):24,425
Checksum:i79C825E9F390E696
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8080Missing in isoform 2. 1 PublicationVSP_038817Add
BLAST
Alternative sequencei189 – 22133ALADV…HYENM → LYDNLLFMEAQISFQEDEPA PGEWSVGLQTWTV in isoform 3. CuratedVSP_038818Add
BLAST
Alternative sequencei222 – 424203Missing in isoform 3. CuratedVSP_038819Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK299610 mRNA. Translation: BAG61539.1.
AC009134 Genomic DNA. No translation available.
AC092324 Genomic DNA. No translation available.
AC092380 Genomic DNA. No translation available.
CCDSiCCDS45417.2. [B4DS77-1]
CCDS45418.2. [B4DS77-3]
RefSeqiNP_001138676.2. NM_001145204.2. [B4DS77-1]
NP_001138677.2. NM_001145205.1. [B4DS77-3]
UniGeneiHs.130661.

Genome annotation databases

EnsembliENST00000423335; ENSP00000395245; ENSG00000237515. [B4DS77-3]
ENST00000558583; ENSP00000454014; ENSG00000237515. [B4DS77-1]
GeneIDi729993.
KEGGihsa:729993.
UCSCiuc002dcd.3. human. [B4DS77-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK299610 mRNA. Translation: BAG61539.1.
AC009134 Genomic DNA. No translation available.
AC092324 Genomic DNA. No translation available.
AC092380 Genomic DNA. No translation available.
CCDSiCCDS45417.2. [B4DS77-1]
CCDS45418.2. [B4DS77-3]
RefSeqiNP_001138676.2. NM_001145204.2. [B4DS77-1]
NP_001138677.2. NM_001145205.1. [B4DS77-3]
UniGeneiHs.130661.

3D structure databases

ProteinModelPortaliB4DS77.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000454014.

PTM databases

iPTMnetiB4DS77.
PhosphoSiteiB4DS77.

Polymorphism and mutation databases

BioMutaiSHISA9.

Proteomic databases

EPDiB4DS77.
PaxDbiB4DS77.
PeptideAtlasiB4DS77.
PRIDEiB4DS77.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000423335; ENSP00000395245; ENSG00000237515. [B4DS77-3]
ENST00000558583; ENSP00000454014; ENSG00000237515. [B4DS77-1]
GeneIDi729993.
KEGGihsa:729993.
UCSCiuc002dcd.3. human. [B4DS77-1]

Organism-specific databases

CTDi729993.
GeneCardsiSHISA9.
HGNCiHGNC:37231. SHISA9.
HPAiHPA053177.
MIMi613346. gene.
neXtProtiNX_B4DS77.
PharmGKBiPA165450677.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK0B. Eukaryota.
ENOG410YB4B. LUCA.
GeneTreeiENSGT00510000047247.
HOGENOMiHOG000169786.
HOVERGENiHBG055090.
InParanoidiB4DS77.
OMAiGSYLYCC.
OrthoDBiEOG7N0C56.
PhylomeDBiB4DS77.

Miscellaneous databases

ChiTaRSiSHISA9. human.
GenomeRNAii729993.
PROiB4DS77.
SOURCEiSearch...

Gene expression databases

BgeeiB4DS77.
GenevisibleiB4DS77. HS.

Family and domain databases

InterProiIPR026910. Shisa.
[Graphical view]
PfamiPF13908. Shisa. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiSHSA9_HUMAN
AccessioniPrimary (citable) accession number: B4DS77
Secondary accession number(s): C9J314, C9JCE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 23, 2010
Last sequence update: May 18, 2010
Last modified: July 6, 2016
This is version 58 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.