Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

B2RTY4

- MYO9A_HUMAN

UniProt

B2RTY4 - MYO9A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Unconventional myosin-IXa

Gene

MYO9A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi239 – 2468ATPSequence Analysis
Zinc fingeri1999 – 204850Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2068 – 211952Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. GTPase activator activity Source: UniProtKB-KW
  3. metal ion binding Source: UniProtKB-KW
  4. motor activity Source: InterPro

GO - Biological processi

  1. regulation of small GTPase mediated signal transduction Source: Reactome
  2. small GTPase mediated signal transduction Source: Reactome
  3. visual perception Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation, Motor protein, Myosin

Keywords - Ligandi

Actin-binding, ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Unconventional myosin-IXa
Alternative name(s):
Unconventional myosin-9a
Gene namesi
Name:MYO9A
Synonyms:MYR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:7608. MYO9A.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. integral component of membrane Source: UniProtKB-KW
  3. unconventional myosin complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31413.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25482548Unconventional myosin-IXaPRO_0000348440Add
BLAST

Proteomic databases

MaxQBiB2RTY4.
PaxDbiB2RTY4.
PeptideAtlasiQ14787.
PRIDEiB2RTY4.

Expressioni

Tissue specificityi

Found to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver. Isoform 5 was found in leukocytes but not in brain, retina or testis.1 Publication

Gene expression databases

BgeeiB2RTY4.
ExpressionAtlasiB2RTY4. baseline and differential.
GenevestigatoriB2RTY4.

Organism-specific databases

HPAiHPA039812.
HPA040071.

Interactioni

Protein-protein interaction databases

BioGridi110733. 7 interactions.
IntActiB2RTY4. 5 interactions.
MINTiMINT-1425451.

Structurei

3D structure databases

ProteinModelPortaliB2RTY4.
SMRiB2RTY4. Positions 141-1067, 1130-1163, 1993-2244.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei175 – 19521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini14 – 11299Ras-associatingPROSITE-ProRule annotationAdd
BLAST
Domaini146 – 1016871Myosin motorAdd
BLAST
Domaini1021 – 104121IQ 1PROSITE-ProRule annotationAdd
BLAST
Domaini1042 – 107130IQ 2PROSITE-ProRule annotationAdd
BLAST
Domaini1074 – 110330IQ 3PROSITE-ProRule annotationAdd
BLAST
Domaini1115 – 114430IQ 4PROSITE-ProRule annotationAdd
BLAST
Domaini1138 – 116730IQ 5PROSITE-ProRule annotationAdd
BLAST
Domaini2063 – 2251189Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni907 – 91812Actin-bindingBy similarityAdd
BLAST
Regioni1021 – 1162142Neck or regulatory domainAdd
BLAST
Regioni1163 – 25111349TailAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1264 – 129128Sequence AnalysisAdd
BLAST
Coiled coili1486 – 153247Sequence AnalysisAdd
BLAST
Coiled coili2315 – 235844Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 5 IQ domains.PROSITE-ProRule annotation
Contains 1 myosin motor domain.Curated
Contains 2 phorbol-ester/DAG-type zinc fingers.PROSITE-ProRule annotation
Contains 1 Ras-associating domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri1999 – 204850Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2068 – 211952Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiCOG5022.
GeneTreeiENSGT00760000119009.
HOVERGENiHBG108165.
InParanoidiB2RTY4.
KOiK10360.
OMAiHGILMRN.
OrthoDBiEOG7CK35Z.
PhylomeDBiB2RTY4.
TreeFamiTF316834.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. PE/DAG-bd.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR13140:SF9. PTHR13140:SF9. 1 hit.
PfamiPF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50096. IQ. 4 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: B2RTY4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNINDGGRRR FEDNEHTLRI YPGAISEGTI YCPIPARKNS TAAEVIESLI
60 70 80 90 100
NKLHLDKTKC YVLAEVKEFG GEEWILNPTD CPVQRMMLWP RMALENRLSG
110 120 130 140 150
EDYRFLLREK NLDGSIHYGS LQSWLRVTEE RRRMMERGFL PQPQQKDFDD
160 170 180 190 200
LCSLPDLNEK TLLENLRNRF KHEKIYTYVG SILIVINPFK FLPIYNPKYV
210 220 230 240 250
KMYDNHQLGK LEPHIYAVAD VAYHAMLQRK KNQCIVISGE SGSGKTQSTN
260 270 280 290 300
FLIHHLTALS QKGFASGVEQ IILGAGPVLE AFGNAKTAHN NNSSRFGKFI
310 320 330 340 350
QVNYQETGTV LGAYVEKYLL EKSRLVYQEH NERNYHVFYY LLAGASEDER
360 370 380 390 400
SAFHLKQPEE YHYLNQITKK PLRQSWDDYC YDSEPDCFTV EGEDLRHDFE
410 420 430 440 450
RLQLAMEMVG FLPKTRRQIF SLLSAILHLG NICYKKKTYR DDSIDICNPE
460 470 480 490 500
VLPIVSELLE VKEEMLFEAL VTRKTVTVGE KLILPYKLAE AVTVRNSMAK
510 520 530 540 550
SLYSALFDWI VFRINHALLN SKDLEHNTKT LSIGVLDIFG FEDYENNSFE
560 570 580 590 600
QFCINFANER LQHYFNQHIF KLEQEEYRTE GISWHNIDYI DNTCCINLIS
610 620 630 640 650
KKPTGLLHLL DEESNFPQAT NQTLLDKFKH QHEDNSYIEF PAVMEPAFII
660 670 680 690 700
KHYAGKVKYG VKDFREKNTD HMRPDIVALL RSSKNAFISG MIGIDPVAVF
710 720 730 740 750
RWAILRAFFR AMVAFREAGK RNIHRKTGHD DTAPCAILKS MDSFSFLQHP
760 770 780 790 800
VHQRSLEILQ RCKEEKYSIT RKNPRTPLSD LQGMNALNEK NQHDTFDIAW
810 820 830 840 850
NGRTGIRQSR LSSGTSLLDK DGIFANSTSS KLLERAHGIL TRNKNFKSKP
860 870 880 890 900
ALPKHLLEVN SLKHLTRLTL QDRITKSLLH LHKKKKPPSI SAQFQASLSK
910 920 930 940 950
LMETLGQAEP YFVKCIRSNA EKLPLRFSDV LVLRQLRYTG MLETVRIRQS
960 970 980 990 1000
GYSSKYSFQD FVSHFHVLLP RNIIPSKFNI QDFFRKINLN PDNYQVGKTM
1010 1020 1030 1040 1050
VFLKEQERQH LQDLLHQEVL RRIILLQRWF RVLLCRQHFL HLRQASVIIQ
1060 1070 1080 1090 1100
RFWRNYLNQK QVRDAAVQKD AFVMASAAAL LQASWRAHLE RQRYLELRAA
1110 1120 1130 1140 1150
AIVIQQKWRD YYRRRHMAAI CIQARWKAYR ESKRYQEQRK KIILLQSTCR
1160 1170 1180 1190 1200
GFRARQRFKA LKEQRLRETK PEVGLVNIKG YGSLEIQGSD PSGWEDCSFD
1210 1220 1230 1240 1250
NRIKAIEECK SVIESNRISR ESSVDCLKES PNKQQERAQS QSGVDLQEDV
1260 1270 1280 1290 1300
LVRERPRSLE DLHQKKVGRA KRESRRMREL EQAIFSLELL KVRSLGGISP
1310 1320 1330 1340 1350
SEDRRWSTEL VPEGLQSPRG TPDSESSQGS LELLSYEESQ KSKLESVISD
1360 1370 1380 1390 1400
EGDLQFPSPK ISSSPKFDSR DNALSASNET SSAEHLKDGT MKEMVVCSSE
1410 1420 1430 1440 1450
SITCKPQLKD SFISNSLPTF FYIPQQDPLK TNSQLDTSIQ RNKLLENEDT
1460 1470 1480 1490 1500
AGEALTLDIN RETRRYHCSG KDQIVPSLNT ESSNPVLKKL EKLNTEKEER
1510 1520 1530 1540 1550
QKQLQQQNEK EMMEQIRQQT DILEKERKAF KTIEKPRIGE CLVAPSSYQS
1560 1570 1580 1590 1600
KQRVERPSSL LSLNTSNKGE LNVLGSLSLK DAALAQKDSS SAHLPPKDRP
1610 1620 1630 1640 1650
VTVFFERKGS PCQSSTVKEL SKTDRMGTQL NVACKLSNNR ISKREHFRPT
1660 1670 1680 1690 1700
QSYSHNSDDL SREGNARPIF FTPKDNMSIP LVSKEALNSK NPQLHKEDEP
1710 1720 1730 1740 1750
AWKPVKLAGP GQRETSQRFS SVDEQAKLHK TMSQGEITKL AVRQKASDSD
1760 1770 1780 1790 1800
IRPQRAKMRF WAKGKQGEKK TTRVKPTTQS EVSPLFAGTD VIPAHQFPDE
1810 1820 1830 1840 1850
LAAYHPTPPL SPELPGSCRK EFKENKEPSP KAKRKRSVKI SNVALDSMHW
1860 1870 1880 1890 1900
QNDSVQIIAS VSDLKSMDEF LLKKVNDLDN EDSKKDTLVD VVFKKALKEF
1910 1920 1930 1940 1950
RQNIFSFYSS ALAMDDGKSI RYKDLYALFE QILEKTMRLE QRDSLGESPV
1960 1970 1980 1990 2000
RVWVNTFKVF LDEYMNEFKT SDCTATKVPK TERKKRRKKE TDLVEEHNGH
2010 2020 2030 2040 2050
IFKATQYSIP TYCEYCSSLI WIMDRASVCK LCKYACHKKC CLKTTAKCSK
2060 2070 2080 2090 2100
KYDPELSSRQ FGVELSRLTS EDRTVPLVVE KLINYIEMHG LYTEGIYRKS
2110 2120 2130 2140 2150
GSTNKIKELR QGLDTDAESV NLDDYNIHVI ASVFKQWLRD LPNPLMTFEL
2160 2170 2180 2190 2200
YEEFLRAMGL QERKETIRGV YSVIDQLSRT HLNTLERLIF HLVRIALQED
2210 2220 2230 2240 2250
TNRMSANALA IVFAPCILRC PDTTDPLQSV QDISKTTTCV ELIVVEQMNK
2260 2270 2280 2290 2300
YKARLKDISS LEFAENKAKT RLSLIRRSMG KGRIRRGNYP GPSSPVVVRL
2310 2320 2330 2340 2350
PSVSDVSEET LTSEAAMETD ITEQQQAAMQ QEERVLTEQI ENLQKEKEEL
2360 2370 2380 2390 2400
TFEMLVLEPR ASDDETLESE ASIGTADSSE NLNMESEYAI SEKSERSLAL
2410 2420 2430 2440 2450
SSLKTAGKSE PSSKLRKQLK KQQDSLDVVD SSVSSLCLSN TASSHGTRKL
2460 2470 2480 2490 2500
FQIYSKSPFY RAASGNEALG MEGPLGQTKF LEDKPQFISR GTFNPEKGKQ
2510 2520 2530 2540
KLKNVKNSPQ KTKETPEGTV MSGRRKTVDP DCTSNQQLAL FGNNEFMV
Length:2,548
Mass (Da):292,706
Last modified:May 18, 2010 - v2
Checksum:i867835BD2B841C84
GO
Isoform 2 (identifier: B2RTY4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-385: Missing.

Note: No experimental confirmation available.

Show »
Length:2,529
Mass (Da):290,379
Checksum:i6024586FEA633B1C
GO
Isoform 3 (identifier: B2RTY4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-729: H → K
     730-2548: Missing.

Note: No experimental confirmation available.

Show »
Length:729
Mass (Da):84,679
Checksum:iC7529CD8EB711767
GO
Isoform 4 (identifier: B2RTY4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1714-1714: E → EVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEM

Show »
Length:2,619
Mass (Da):300,433
Checksum:iE19A84D21D057FB0
GO
Isoform 5 (identifier: B2RTY4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-280: Missing.

Note: Lacks the ATP-binding domain which suggests that it cannot interact with actin.

Show »
Length:2,312
Mass (Da):265,414
Checksum:iD00A255132D264DC
GO

Sequence cautioni

The sequence BAA91979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB14517.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881L → R in CAA04947. (PubMed:9819351)Curated
Sequence conflicti94 – 941L → Q in CAA04947. (PubMed:9819351)Curated
Sequence conflicti104 – 1041R → H in CAA04947. (PubMed:9819351)Curated
Sequence conflicti206 – 2061H → R in CAA04947. (PubMed:9819351)Curated
Sequence conflicti394 – 3941D → N in CAA04947. (PubMed:9819351)Curated
Sequence conflicti424 – 4241S → P in CAA04947. (PubMed:9819351)Curated
Sequence conflicti504 – 5041S → C in CAA04947. (PubMed:9819351)Curated
Sequence conflicti573 – 5731E → D in CAA04947. (PubMed:9819351)Curated
Sequence conflicti595 – 5951C → Y in CAA04947. (PubMed:9819351)Curated
Sequence conflicti694 – 6941I → M in CAA04947. (PubMed:9819351)Curated
Sequence conflicti705 – 7051L → I in CAA04947. (PubMed:9819351)Curated
Sequence conflicti1591 – 15911S → P in BAB14517. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti37 – 371R → K.1 Publication
Corresponds to variant rs17855105 [ dbSNP | Ensembl ].
VAR_046165
Natural varianti85 – 851R → Q.1 Publication
VAR_046166
Natural varianti161 – 1611T → I.
Corresponds to variant rs2929516 [ dbSNP | Ensembl ].
VAR_046167
Natural varianti168 – 1681N → D.1 Publication
VAR_046168
Natural varianti211 – 2111L → P.1 Publication
VAR_046169
Natural varianti825 – 8251A → V.
Corresponds to variant rs11637562 [ dbSNP | Ensembl ].
VAR_056189
Natural varianti946 – 9461R → Q.1 Publication
VAR_046170
Natural varianti1193 – 11931G → E.4 Publications
Corresponds to variant rs2415129 [ dbSNP | Ensembl ].
VAR_046171
Natural varianti1362 – 13621S → P.1 Publication
Corresponds to variant rs55738821 [ dbSNP | Ensembl ].
VAR_046172
Natural varianti1476 – 14761P → R.
Corresponds to variant rs16956375 [ dbSNP | Ensembl ].
VAR_046173
Natural varianti1795 – 17951H → Y.
Corresponds to variant rs16956367 [ dbSNP | Ensembl ].
VAR_046174
Natural varianti1805 – 18051H → Q.
Corresponds to variant rs2306575 [ dbSNP | Ensembl ].
VAR_046175
Natural varianti1834 – 18341R → C.1 Publication
VAR_046176
Natural varianti2390 – 23901I → V.
Corresponds to variant rs2291280 [ dbSNP | Ensembl ].
VAR_046177

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei45 – 280236Missing in isoform 5. 1 PublicationVSP_035156Add
BLAST
Alternative sequencei367 – 38519Missing in isoform 2. CuratedVSP_035157Add
BLAST
Alternative sequencei729 – 7291H → K in isoform 3. 1 PublicationVSP_035158
Alternative sequencei730 – 25481819Missing in isoform 3. 1 PublicationVSP_035159Add
BLAST
Alternative sequencei1714 – 17141E → EVARPAHKKKARMARTRSDF LTRGTFADGEGDTEEDDYDD IIEPLLSLDQASHCELGPAP SLGQASHSDSEM in isoform 4. 2 PublicationsVSP_035160

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF117888 mRNA. Translation: AAD49195.1.
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1.
BC060886 mRNA. Translation: AAH60886.1.
BC140869 mRNA. Translation: AAI40870.1.
AJ001714 mRNA. Translation: CAA04947.1.
AB290183 mRNA. Translation: BAG06737.1.
L29148 mRNA. Translation: AAA20911.1.
DQ088983 mRNA. Translation: AAZ85978.1.
DQ088984 mRNA. Translation: AAZ85979.1.
AL137287 mRNA. Translation: CAB70679.1.
AK001923 mRNA. Translation: BAA91979.1. Different initiation.
AK023306 mRNA. Translation: BAB14517.1. Different initiation.
CCDSiCCDS10239.1. [B2RTY4-1]
PIRiE59435.
I61699.
T46354.
RefSeqiNP_008832.2. NM_006901.3. [B2RTY4-1]
XP_006720602.1. XM_006720539.1. [B2RTY4-4]
XP_006720603.1. XM_006720540.1. [B2RTY4-4]
UniGeneiHs.513000.
Hs.546268.
Hs.733087.

Genome annotation databases

EnsembliENST00000356056; ENSP00000348349; ENSG00000066933. [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933. [B2RTY4-3]
ENST00000444904; ENSP00000398250; ENSG00000066933. [B2RTY4-1]
GeneIDi4649.
KEGGihsa:4649.
UCSCiuc002atl.5. human. [B2RTY4-1]
uc002atn.1. human. [B2RTY4-4]
uc002ato.4. human. [B2RTY4-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF117888 mRNA. Translation: AAD49195.1 .
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1 .
BC060886 mRNA. Translation: AAH60886.1 .
BC140869 mRNA. Translation: AAI40870.1 .
AJ001714 mRNA. Translation: CAA04947.1 .
AB290183 mRNA. Translation: BAG06737.1 .
L29148 mRNA. Translation: AAA20911.1 .
DQ088983 mRNA. Translation: AAZ85978.1 .
DQ088984 mRNA. Translation: AAZ85979.1 .
AL137287 mRNA. Translation: CAB70679.1 .
AK001923 mRNA. Translation: BAA91979.1 . Different initiation.
AK023306 mRNA. Translation: BAB14517.1 . Different initiation.
CCDSi CCDS10239.1. [B2RTY4-1 ]
PIRi E59435.
I61699.
T46354.
RefSeqi NP_008832.2. NM_006901.3. [B2RTY4-1 ]
XP_006720602.1. XM_006720539.1. [B2RTY4-4 ]
XP_006720603.1. XM_006720540.1. [B2RTY4-4 ]
UniGenei Hs.513000.
Hs.546268.
Hs.733087.

3D structure databases

ProteinModelPortali B2RTY4.
SMRi B2RTY4. Positions 141-1067, 1130-1163, 1993-2244.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110733. 7 interactions.
IntActi B2RTY4. 5 interactions.
MINTi MINT-1425451.

Proteomic databases

MaxQBi B2RTY4.
PaxDbi B2RTY4.
PeptideAtlasi Q14787.
PRIDEi B2RTY4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000356056 ; ENSP00000348349 ; ENSG00000066933 . [B2RTY4-1 ]
ENST00000424560 ; ENSP00000399162 ; ENSG00000066933 . [B2RTY4-3 ]
ENST00000444904 ; ENSP00000398250 ; ENSG00000066933 . [B2RTY4-1 ]
GeneIDi 4649.
KEGGi hsa:4649.
UCSCi uc002atl.5. human. [B2RTY4-1 ]
uc002atn.1. human. [B2RTY4-4 ]
uc002ato.4. human. [B2RTY4-3 ]

Organism-specific databases

CTDi 4649.
GeneCardsi GC15M072114.
H-InvDB HIX0012401.
HGNCi HGNC:7608. MYO9A.
HPAi HPA039812.
HPA040071.
MIMi 604875. gene.
neXtProti NX_B2RTY4.
PharmGKBi PA31413.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5022.
GeneTreei ENSGT00760000119009.
HOVERGENi HBG108165.
InParanoidi B2RTY4.
KOi K10360.
OMAi HGILMRN.
OrthoDBi EOG7CK35Z.
PhylomeDBi B2RTY4.
TreeFami TF316834.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

GenomeRNAii 4649.
NextBioi 17924.
PROi B2RTY4.
SOURCEi Search...

Gene expression databases

Bgeei B2RTY4.
ExpressionAtlasi B2RTY4. baseline and differential.
Genevestigatori B2RTY4.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
InterProi IPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. PE/DAG-bd.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
PANTHERi PTHR13140:SF9. PTHR13140:SF9. 1 hit.
Pfami PF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view ]
PRINTSi PR00193. MYOSINHEAVY.
SMARTi SM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
SSF54236. SSF54236. 1 hit.
PROSITEi PS50096. IQ. 4 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The cloning and developmental expression of unconventional myosin IXA (MYO9A) a gene in the Bardet-Biedl syndrome (BBS4) region at chromosome 15q22-q23."
    Gorman S.W., Haider N.B., Grieshammer U., Swiderski R.E., Kim E., Welch J.W., Searby C., Leng S., Carmi R., Sheffield V.C., Duhl D.M.
    Genomics 59:150-160(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), TISSUE SPECIFICITY, VARIANTS GLN-85; ASP-168; PRO-211; GLN-946; GLU-1193; PRO-1362 AND CYS-1834.
  2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1193.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS LYS-37 AND GLU-1193.
    Tissue: Placenta.
  5. "Myr 7 is a novel myosin IX-RhoGAP expressed in rat brain."
    Chieregatti E., Gaertner A., Stoeffler H.-E., Baehler M.
    J. Cell Sci. 111:3597-3608(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-774 (ISOFORMS 1/4).
  6. "Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins."
    Yamakawa H., Kikuno R.F., Nagase T., Ohara O.
    Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-2548 (ISOFORM 1), VARIANT GLU-1193.
    Tissue: Brain.
  7. "Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types."
    Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S.
    Proc. Natl. Acad. Sci. U.S.A. 91:6549-6553(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 234-322 (ISOFORMS 1/2/3/4).
  8. "Non-EST based prediction of exon skipping and intron retention events using Pfam information."
    Hiller M., Huse K., Platzer M., Backofen R.
    Nucleic Acids Res. 33:5611-5621(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 292-445 (ISOFORMS 1/2/3/4/5).
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1223-2548 (ISOFORM 4).
    Tissue: Testis.
  10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1457-1981 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1984-2548 (ISOFORMS 1/2/4/5).
    Tissue: Ovary and Placenta.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMYO9A_HUMAN
AccessioniPrimary (citable) accession number: B2RTY4
Secondary accession number(s): B0I1T5
, C9IYB3, C9JA86, Q14787, Q3YLD7, Q3YLD8, Q6P986, Q9H8T5, Q9NTG2, Q9NUY2, Q9UEP3, Q9UNJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 68 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3