SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

B2RTY4

- MYO9A_HUMAN

UniProt

B2RTY4 - MYO9A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Unconventional myosin-IXa
Gene
MYO9A, MYR7
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi239 – 2468ATP Reviewed prediction
Zinc fingeri1999 – 204850Phorbol-ester/DAG-type 1
Add
BLAST
Zinc fingeri2068 – 211952Phorbol-ester/DAG-type 2
Add
BLAST

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. GTPase activator activity Source: UniProtKB-KW
  3. metal ion binding Source: UniProtKB-KW
  4. motor activity Source: InterPro
  5. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. regulation of small GTPase mediated signal transduction Source: Reactome
  2. small GTPase mediated signal transduction Source: Reactome
  3. visual perception Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation, Motor protein, Myosin

Keywords - Ligandi

Actin-binding, ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Unconventional myosin-IXa
Alternative name(s):
Unconventional myosin-9a
Gene namesi
Name:MYO9A
Synonyms:MYR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:7608. MYO9A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei175 – 19521Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. integral component of membrane Source: UniProtKB-KW
  3. unconventional myosin complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31413.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25482548Unconventional myosin-IXa
PRO_0000348440Add
BLAST

Proteomic databases

MaxQBiB2RTY4.
PaxDbiB2RTY4.
PeptideAtlasiQ14787.
PRIDEiB2RTY4.

Expressioni

Tissue specificityi

Found to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver. Isoform 5 was found in leukocytes but not in brain, retina or testis.1 Publication

Gene expression databases

ArrayExpressiB2RTY4.
BgeeiB2RTY4.
GenevestigatoriB2RTY4.

Organism-specific databases

HPAiHPA039812.
HPA040071.

Interactioni

Protein-protein interaction databases

BioGridi110733. 5 interactions.
IntActiB2RTY4. 5 interactions.
MINTiMINT-1425451.

Structurei

3D structure databases

ProteinModelPortaliB2RTY4.
SMRiB2RTY4. Positions 145-1057, 1132-1162, 1993-2244.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini14 – 11299Ras-associating
Add
BLAST
Domaini146 – 1016871Myosin motor
Add
BLAST
Domaini1021 – 104121IQ 1
Add
BLAST
Domaini1042 – 107130IQ 2
Add
BLAST
Domaini1074 – 110330IQ 3
Add
BLAST
Domaini1115 – 114430IQ 4
Add
BLAST
Domaini1138 – 116730IQ 5
Add
BLAST
Domaini2063 – 2251189Rho-GAP
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni907 – 91812Actin-binding By similarity
Add
BLAST
Regioni1021 – 1162142Neck or regulatory domain
Add
BLAST
Regioni1163 – 25111349Tail
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1264 – 129128 Reviewed prediction
Add
BLAST
Coiled coili1486 – 153247 Reviewed prediction
Add
BLAST
Coiled coili2315 – 235844 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Contains 5 IQ domains.
Contains 1 Rho-GAP domain.

Keywords - Domaini

Coiled coil, Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiCOG5022.
HOVERGENiHBG108165.
InParanoidiB2RTY4.
KOiK10360.
OMAiHGILMRN.
OrthoDBiEOG7CK35Z.
PhylomeDBiB2RTY4.
TreeFamiTF316834.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR13140:SF9. PTHR13140:SF9. 1 hit.
PfamiPF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50096. IQ. 4 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: B2RTY4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNINDGGRRR FEDNEHTLRI YPGAISEGTI YCPIPARKNS TAAEVIESLI     50
NKLHLDKTKC YVLAEVKEFG GEEWILNPTD CPVQRMMLWP RMALENRLSG 100
EDYRFLLREK NLDGSIHYGS LQSWLRVTEE RRRMMERGFL PQPQQKDFDD 150
LCSLPDLNEK TLLENLRNRF KHEKIYTYVG SILIVINPFK FLPIYNPKYV 200
KMYDNHQLGK LEPHIYAVAD VAYHAMLQRK KNQCIVISGE SGSGKTQSTN 250
FLIHHLTALS QKGFASGVEQ IILGAGPVLE AFGNAKTAHN NNSSRFGKFI 300
QVNYQETGTV LGAYVEKYLL EKSRLVYQEH NERNYHVFYY LLAGASEDER 350
SAFHLKQPEE YHYLNQITKK PLRQSWDDYC YDSEPDCFTV EGEDLRHDFE 400
RLQLAMEMVG FLPKTRRQIF SLLSAILHLG NICYKKKTYR DDSIDICNPE 450
VLPIVSELLE VKEEMLFEAL VTRKTVTVGE KLILPYKLAE AVTVRNSMAK 500
SLYSALFDWI VFRINHALLN SKDLEHNTKT LSIGVLDIFG FEDYENNSFE 550
QFCINFANER LQHYFNQHIF KLEQEEYRTE GISWHNIDYI DNTCCINLIS 600
KKPTGLLHLL DEESNFPQAT NQTLLDKFKH QHEDNSYIEF PAVMEPAFII 650
KHYAGKVKYG VKDFREKNTD HMRPDIVALL RSSKNAFISG MIGIDPVAVF 700
RWAILRAFFR AMVAFREAGK RNIHRKTGHD DTAPCAILKS MDSFSFLQHP 750
VHQRSLEILQ RCKEEKYSIT RKNPRTPLSD LQGMNALNEK NQHDTFDIAW 800
NGRTGIRQSR LSSGTSLLDK DGIFANSTSS KLLERAHGIL TRNKNFKSKP 850
ALPKHLLEVN SLKHLTRLTL QDRITKSLLH LHKKKKPPSI SAQFQASLSK 900
LMETLGQAEP YFVKCIRSNA EKLPLRFSDV LVLRQLRYTG MLETVRIRQS 950
GYSSKYSFQD FVSHFHVLLP RNIIPSKFNI QDFFRKINLN PDNYQVGKTM 1000
VFLKEQERQH LQDLLHQEVL RRIILLQRWF RVLLCRQHFL HLRQASVIIQ 1050
RFWRNYLNQK QVRDAAVQKD AFVMASAAAL LQASWRAHLE RQRYLELRAA 1100
AIVIQQKWRD YYRRRHMAAI CIQARWKAYR ESKRYQEQRK KIILLQSTCR 1150
GFRARQRFKA LKEQRLRETK PEVGLVNIKG YGSLEIQGSD PSGWEDCSFD 1200
NRIKAIEECK SVIESNRISR ESSVDCLKES PNKQQERAQS QSGVDLQEDV 1250
LVRERPRSLE DLHQKKVGRA KRESRRMREL EQAIFSLELL KVRSLGGISP 1300
SEDRRWSTEL VPEGLQSPRG TPDSESSQGS LELLSYEESQ KSKLESVISD 1350
EGDLQFPSPK ISSSPKFDSR DNALSASNET SSAEHLKDGT MKEMVVCSSE 1400
SITCKPQLKD SFISNSLPTF FYIPQQDPLK TNSQLDTSIQ RNKLLENEDT 1450
AGEALTLDIN RETRRYHCSG KDQIVPSLNT ESSNPVLKKL EKLNTEKEER 1500
QKQLQQQNEK EMMEQIRQQT DILEKERKAF KTIEKPRIGE CLVAPSSYQS 1550
KQRVERPSSL LSLNTSNKGE LNVLGSLSLK DAALAQKDSS SAHLPPKDRP 1600
VTVFFERKGS PCQSSTVKEL SKTDRMGTQL NVACKLSNNR ISKREHFRPT 1650
QSYSHNSDDL SREGNARPIF FTPKDNMSIP LVSKEALNSK NPQLHKEDEP 1700
AWKPVKLAGP GQRETSQRFS SVDEQAKLHK TMSQGEITKL AVRQKASDSD 1750
IRPQRAKMRF WAKGKQGEKK TTRVKPTTQS EVSPLFAGTD VIPAHQFPDE 1800
LAAYHPTPPL SPELPGSCRK EFKENKEPSP KAKRKRSVKI SNVALDSMHW 1850
QNDSVQIIAS VSDLKSMDEF LLKKVNDLDN EDSKKDTLVD VVFKKALKEF 1900
RQNIFSFYSS ALAMDDGKSI RYKDLYALFE QILEKTMRLE QRDSLGESPV 1950
RVWVNTFKVF LDEYMNEFKT SDCTATKVPK TERKKRRKKE TDLVEEHNGH 2000
IFKATQYSIP TYCEYCSSLI WIMDRASVCK LCKYACHKKC CLKTTAKCSK 2050
KYDPELSSRQ FGVELSRLTS EDRTVPLVVE KLINYIEMHG LYTEGIYRKS 2100
GSTNKIKELR QGLDTDAESV NLDDYNIHVI ASVFKQWLRD LPNPLMTFEL 2150
YEEFLRAMGL QERKETIRGV YSVIDQLSRT HLNTLERLIF HLVRIALQED 2200
TNRMSANALA IVFAPCILRC PDTTDPLQSV QDISKTTTCV ELIVVEQMNK 2250
YKARLKDISS LEFAENKAKT RLSLIRRSMG KGRIRRGNYP GPSSPVVVRL 2300
PSVSDVSEET LTSEAAMETD ITEQQQAAMQ QEERVLTEQI ENLQKEKEEL 2350
TFEMLVLEPR ASDDETLESE ASIGTADSSE NLNMESEYAI SEKSERSLAL 2400
SSLKTAGKSE PSSKLRKQLK KQQDSLDVVD SSVSSLCLSN TASSHGTRKL 2450
FQIYSKSPFY RAASGNEALG MEGPLGQTKF LEDKPQFISR GTFNPEKGKQ 2500
KLKNVKNSPQ KTKETPEGTV MSGRRKTVDP DCTSNQQLAL FGNNEFMV 2548
Length:2,548
Mass (Da):292,706
Last modified:May 18, 2010 - v2
Checksum:i867835BD2B841C84
GO
Isoform 2 (identifier: B2RTY4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-385: Missing.

Note: No experimental confirmation available.

Show »
Length:2,529
Mass (Da):290,379
Checksum:i6024586FEA633B1C
GO
Isoform 3 (identifier: B2RTY4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-729: H → K
     730-2548: Missing.

Note: No experimental confirmation available.

Show »
Length:729
Mass (Da):84,679
Checksum:iC7529CD8EB711767
GO
Isoform 4 (identifier: B2RTY4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1714-1714: E → EVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEM

Show »
Length:2,619
Mass (Da):300,433
Checksum:iE19A84D21D057FB0
GO
Isoform 5 (identifier: B2RTY4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-280: Missing.

Note: Lacks the ATP-binding domain which suggests that it cannot interact with actin.

Show »
Length:2,312
Mass (Da):265,414
Checksum:iD00A255132D264DC
GO

Sequence cautioni

The sequence BAA91979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB14517.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti37 – 371R → K.1 Publication
Corresponds to variant rs17855105 [ dbSNP | Ensembl ].
VAR_046165
Natural varianti85 – 851R → Q.1 Publication
VAR_046166
Natural varianti161 – 1611T → I.
Corresponds to variant rs2929516 [ dbSNP | Ensembl ].
VAR_046167
Natural varianti168 – 1681N → D.1 Publication
VAR_046168
Natural varianti211 – 2111L → P.1 Publication
VAR_046169
Natural varianti825 – 8251A → V.
Corresponds to variant rs11637562 [ dbSNP | Ensembl ].
VAR_056189
Natural varianti946 – 9461R → Q.1 Publication
VAR_046170
Natural varianti1193 – 11931G → E.4 Publications
Corresponds to variant rs2415129 [ dbSNP | Ensembl ].
VAR_046171
Natural varianti1362 – 13621S → P.1 Publication
Corresponds to variant rs55738821 [ dbSNP | Ensembl ].
VAR_046172
Natural varianti1476 – 14761P → R.
Corresponds to variant rs16956375 [ dbSNP | Ensembl ].
VAR_046173
Natural varianti1795 – 17951H → Y.
Corresponds to variant rs16956367 [ dbSNP | Ensembl ].
VAR_046174
Natural varianti1805 – 18051H → Q.
Corresponds to variant rs2306575 [ dbSNP | Ensembl ].
VAR_046175
Natural varianti1834 – 18341R → C.1 Publication
VAR_046176
Natural varianti2390 – 23901I → V.
Corresponds to variant rs2291280 [ dbSNP | Ensembl ].
VAR_046177

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei45 – 280236Missing in isoform 5.
VSP_035156Add
BLAST
Alternative sequencei367 – 38519Missing in isoform 2.
VSP_035157Add
BLAST
Alternative sequencei729 – 7291H → K in isoform 3.
VSP_035158
Alternative sequencei730 – 25481819Missing in isoform 3.
VSP_035159Add
BLAST
Alternative sequencei1714 – 17141E → EVARPAHKKKARMARTRSDF LTRGTFADGEGDTEEDDYDD IIEPLLSLDQASHCELGPAP SLGQASHSDSEM in isoform 4.
VSP_035160

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881L → R in CAA04947. 1 Publication
Sequence conflicti94 – 941L → Q in CAA04947. 1 Publication
Sequence conflicti104 – 1041R → H in CAA04947. 1 Publication
Sequence conflicti206 – 2061H → R in CAA04947. 1 Publication
Sequence conflicti394 – 3941D → N in CAA04947. 1 Publication
Sequence conflicti424 – 4241S → P in CAA04947. 1 Publication
Sequence conflicti504 – 5041S → C in CAA04947. 1 Publication
Sequence conflicti573 – 5731E → D in CAA04947. 1 Publication
Sequence conflicti595 – 5951C → Y in CAA04947. 1 Publication
Sequence conflicti694 – 6941I → M in CAA04947. 1 Publication
Sequence conflicti705 – 7051L → I in CAA04947. 1 Publication
Sequence conflicti1591 – 15911S → P in BAB14517. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF117888 mRNA. Translation: AAD49195.1.
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1.
BC060886 mRNA. Translation: AAH60886.1.
BC140869 mRNA. Translation: AAI40870.1.
AJ001714 mRNA. Translation: CAA04947.1.
AB290183 mRNA. Translation: BAG06737.1.
L29148 mRNA. Translation: AAA20911.1.
DQ088983 mRNA. Translation: AAZ85978.1.
DQ088984 mRNA. Translation: AAZ85979.1.
AL137287 mRNA. Translation: CAB70679.1.
AK001923 mRNA. Translation: BAA91979.1. Different initiation.
AK023306 mRNA. Translation: BAB14517.1. Different initiation.
CCDSiCCDS10239.1. [B2RTY4-1]
PIRiE59435.
I61699.
T46354.
RefSeqiNP_008832.2. NM_006901.3. [B2RTY4-1]
XP_006720602.1. XM_006720539.1. [B2RTY4-4]
XP_006720603.1. XM_006720540.1. [B2RTY4-4]
UniGeneiHs.513000.
Hs.546268.
Hs.733087.

Genome annotation databases

EnsembliENST00000356056; ENSP00000348349; ENSG00000066933. [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933. [B2RTY4-4]
ENST00000444904; ENSP00000398250; ENSG00000066933. [B2RTY4-2]
GeneIDi4649.
KEGGihsa:4649.
UCSCiuc002atl.5. human. [B2RTY4-1]
uc002atn.1. human. [B2RTY4-4]
uc002ato.4. human. [B2RTY4-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF117888 mRNA. Translation: AAD49195.1 .
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1 .
BC060886 mRNA. Translation: AAH60886.1 .
BC140869 mRNA. Translation: AAI40870.1 .
AJ001714 mRNA. Translation: CAA04947.1 .
AB290183 mRNA. Translation: BAG06737.1 .
L29148 mRNA. Translation: AAA20911.1 .
DQ088983 mRNA. Translation: AAZ85978.1 .
DQ088984 mRNA. Translation: AAZ85979.1 .
AL137287 mRNA. Translation: CAB70679.1 .
AK001923 mRNA. Translation: BAA91979.1 . Different initiation.
AK023306 mRNA. Translation: BAB14517.1 . Different initiation.
CCDSi CCDS10239.1. [B2RTY4-1 ]
PIRi E59435.
I61699.
T46354.
RefSeqi NP_008832.2. NM_006901.3. [B2RTY4-1 ]
XP_006720602.1. XM_006720539.1. [B2RTY4-4 ]
XP_006720603.1. XM_006720540.1. [B2RTY4-4 ]
UniGenei Hs.513000.
Hs.546268.
Hs.733087.

3D structure databases

ProteinModelPortali B2RTY4.
SMRi B2RTY4. Positions 145-1057, 1132-1162, 1993-2244.
ModBasei Search...

Protein-protein interaction databases

BioGridi 110733. 5 interactions.
IntActi B2RTY4. 5 interactions.
MINTi MINT-1425451.

Proteomic databases

MaxQBi B2RTY4.
PaxDbi B2RTY4.
PeptideAtlasi Q14787.
PRIDEi B2RTY4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000356056 ; ENSP00000348349 ; ENSG00000066933 . [B2RTY4-1 ]
ENST00000424560 ; ENSP00000399162 ; ENSG00000066933 . [B2RTY4-4 ]
ENST00000444904 ; ENSP00000398250 ; ENSG00000066933 . [B2RTY4-2 ]
GeneIDi 4649.
KEGGi hsa:4649.
UCSCi uc002atl.5. human. [B2RTY4-1 ]
uc002atn.1. human. [B2RTY4-4 ]
uc002ato.4. human. [B2RTY4-3 ]

Organism-specific databases

CTDi 4649.
GeneCardsi GC15M072114.
H-InvDB HIX0012401.
HGNCi HGNC:7608. MYO9A.
HPAi HPA039812.
HPA040071.
MIMi 604875. gene.
neXtProti NX_B2RTY4.
PharmGKBi PA31413.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5022.
HOVERGENi HBG108165.
InParanoidi B2RTY4.
KOi K10360.
OMAi HGILMRN.
OrthoDBi EOG7CK35Z.
PhylomeDBi B2RTY4.
TreeFami TF316834.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

GenomeRNAii 4649.
NextBioi 17924.
PROi B2RTY4.
SOURCEi Search...

Gene expression databases

ArrayExpressi B2RTY4.
Bgeei B2RTY4.
Genevestigatori B2RTY4.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
InterProi IPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
PANTHERi PTHR13140:SF9. PTHR13140:SF9. 1 hit.
Pfami PF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view ]
PRINTSi PR00193. MYOSINHEAVY.
SMARTi SM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
SSF54236. SSF54236. 1 hit.
PROSITEi PS50096. IQ. 4 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The cloning and developmental expression of unconventional myosin IXA (MYO9A) a gene in the Bardet-Biedl syndrome (BBS4) region at chromosome 15q22-q23."
    Gorman S.W., Haider N.B., Grieshammer U., Swiderski R.E., Kim E., Welch J.W., Searby C., Leng S., Carmi R., Sheffield V.C., Duhl D.M.
    Genomics 59:150-160(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), TISSUE SPECIFICITY, VARIANTS GLN-85; ASP-168; PRO-211; GLN-946; GLU-1193; PRO-1362 AND CYS-1834.
  2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1193.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS LYS-37 AND GLU-1193.
    Tissue: Placenta.
  5. "Myr 7 is a novel myosin IX-RhoGAP expressed in rat brain."
    Chieregatti E., Gaertner A., Stoeffler H.-E., Baehler M.
    J. Cell Sci. 111:3597-3608(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-774 (ISOFORMS 1/4).
  6. "Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins."
    Yamakawa H., Kikuno R.F., Nagase T., Ohara O.
    Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-2548 (ISOFORM 1), VARIANT GLU-1193.
    Tissue: Brain.
  7. "Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types."
    Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S.
    Proc. Natl. Acad. Sci. U.S.A. 91:6549-6553(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 234-322 (ISOFORMS 1/2/3/4).
  8. "Non-EST based prediction of exon skipping and intron retention events using Pfam information."
    Hiller M., Huse K., Platzer M., Backofen R.
    Nucleic Acids Res. 33:5611-5621(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 292-445 (ISOFORMS 1/2/3/4/5).
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1223-2548 (ISOFORM 4).
    Tissue: Testis.
  10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1457-1981 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1984-2548 (ISOFORMS 1/2/4/5).
    Tissue: Ovary and Placenta.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMYO9A_HUMAN
AccessioniPrimary (citable) accession number: B2RTY4
Secondary accession number(s): B0I1T5
, C9IYB3, C9JA86, Q14787, Q3YLD7, Q3YLD8, Q6P986, Q9H8T5, Q9NTG2, Q9NUY2, Q9UEP3, Q9UNJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: May 18, 2010
Last modified: September 3, 2014
This is version 66 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi