Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

B2RTY4

- MYO9A_HUMAN

UniProt

B2RTY4 - MYO9A_HUMAN

Protein

Unconventional myosin-IXa

Gene

MYO9A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 67 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi239 – 2468ATPSequence Analysis
    Zinc fingeri1999 – 204850Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2068 – 211952Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. GTPase activator activity Source: UniProtKB-KW
    3. metal ion binding Source: UniProtKB-KW
    4. motor activity Source: InterPro
    5. protein binding Source: UniProtKB

    GO - Biological processi

    1. regulation of small GTPase mediated signal transduction Source: Reactome
    2. small GTPase mediated signal transduction Source: Reactome
    3. visual perception Source: ProtInc

    Keywords - Molecular functioni

    GTPase activation, Motor protein, Myosin

    Keywords - Ligandi

    Actin-binding, ATP-binding, Metal-binding, Nucleotide-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_11051. Rho GTPase cycle.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Unconventional myosin-IXa
    Alternative name(s):
    Unconventional myosin-9a
    Gene namesi
    Name:MYO9A
    Synonyms:MYR7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:7608. MYO9A.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. integral component of membrane Source: UniProtKB-KW
    3. unconventional myosin complex Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31413.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 25482548Unconventional myosin-IXaPRO_0000348440Add
    BLAST

    Proteomic databases

    MaxQBiB2RTY4.
    PaxDbiB2RTY4.
    PeptideAtlasiQ14787.
    PRIDEiB2RTY4.

    Expressioni

    Tissue specificityi

    Found to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver. Isoform 5 was found in leukocytes but not in brain, retina or testis.1 Publication

    Gene expression databases

    ArrayExpressiB2RTY4.
    BgeeiB2RTY4.
    GenevestigatoriB2RTY4.

    Organism-specific databases

    HPAiHPA039812.
    HPA040071.

    Interactioni

    Protein-protein interaction databases

    BioGridi110733. 5 interactions.
    IntActiB2RTY4. 5 interactions.
    MINTiMINT-1425451.

    Structurei

    3D structure databases

    ProteinModelPortaliB2RTY4.
    SMRiB2RTY4. Positions 145-1057, 1132-1162, 1993-2244.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei175 – 19521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini14 – 11299Ras-associatingPROSITE-ProRule annotationAdd
    BLAST
    Domaini146 – 1016871Myosin motorAdd
    BLAST
    Domaini1021 – 104121IQ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1042 – 107130IQ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1074 – 110330IQ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1115 – 114430IQ 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini1138 – 116730IQ 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini2063 – 2251189Rho-GAPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni907 – 91812Actin-bindingBy similarityAdd
    BLAST
    Regioni1021 – 1162142Neck or regulatory domainAdd
    BLAST
    Regioni1163 – 25111349TailAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili1264 – 129128Sequence AnalysisAdd
    BLAST
    Coiled coili1486 – 153247Sequence AnalysisAdd
    BLAST
    Coiled coili2315 – 235844Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 5 IQ domains.PROSITE-ProRule annotation
    Contains 1 myosin motor domain.Curated
    Contains 2 phorbol-ester/DAG-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 Ras-associating domain.PROSITE-ProRule annotation
    Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri1999 – 204850Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2068 – 211952Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Repeat, Transmembrane, Transmembrane helix, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5022.
    HOVERGENiHBG108165.
    InParanoidiB2RTY4.
    KOiK10360.
    OMAiHGILMRN.
    OrthoDBiEOG7CK35Z.
    PhylomeDBiB2RTY4.
    TreeFamiTF316834.

    Family and domain databases

    Gene3Di1.10.555.10. 1 hit.
    InterProiIPR000048. IQ_motif_EF-hand-BS.
    IPR028558. MYO9A.
    IPR001609. Myosin_head_motor_dom.
    IPR027417. P-loop_NTPase.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR000159. Ras-assoc.
    IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PANTHERiPTHR13140:SF9. PTHR13140:SF9. 1 hit.
    PfamiPF00612. IQ. 4 hits.
    PF00063. Myosin_head. 2 hits.
    PF00788. RA. 1 hit.
    PF00620. RhoGAP. 1 hit.
    [Graphical view]
    PRINTSiPR00193. MYOSINHEAVY.
    SMARTiSM00109. C1. 1 hit.
    SM00015. IQ. 5 hits.
    SM00242. MYSc. 1 hit.
    SM00314. RA. 1 hit.
    SM00324. RhoGAP. 1 hit.
    [Graphical view]
    SUPFAMiSSF48350. SSF48350. 1 hit.
    SSF52540. SSF52540. 3 hits.
    SSF54236. SSF54236. 1 hit.
    PROSITEiPS50096. IQ. 4 hits.
    PS51456. MYOSIN_MOTOR. 1 hit.
    PS50200. RA. 1 hit.
    PS50238. RHOGAP. 1 hit.
    PS00479. ZF_DAG_PE_1. 1 hit.
    PS50081. ZF_DAG_PE_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: B2RTY4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNINDGGRRR FEDNEHTLRI YPGAISEGTI YCPIPARKNS TAAEVIESLI     50
    NKLHLDKTKC YVLAEVKEFG GEEWILNPTD CPVQRMMLWP RMALENRLSG 100
    EDYRFLLREK NLDGSIHYGS LQSWLRVTEE RRRMMERGFL PQPQQKDFDD 150
    LCSLPDLNEK TLLENLRNRF KHEKIYTYVG SILIVINPFK FLPIYNPKYV 200
    KMYDNHQLGK LEPHIYAVAD VAYHAMLQRK KNQCIVISGE SGSGKTQSTN 250
    FLIHHLTALS QKGFASGVEQ IILGAGPVLE AFGNAKTAHN NNSSRFGKFI 300
    QVNYQETGTV LGAYVEKYLL EKSRLVYQEH NERNYHVFYY LLAGASEDER 350
    SAFHLKQPEE YHYLNQITKK PLRQSWDDYC YDSEPDCFTV EGEDLRHDFE 400
    RLQLAMEMVG FLPKTRRQIF SLLSAILHLG NICYKKKTYR DDSIDICNPE 450
    VLPIVSELLE VKEEMLFEAL VTRKTVTVGE KLILPYKLAE AVTVRNSMAK 500
    SLYSALFDWI VFRINHALLN SKDLEHNTKT LSIGVLDIFG FEDYENNSFE 550
    QFCINFANER LQHYFNQHIF KLEQEEYRTE GISWHNIDYI DNTCCINLIS 600
    KKPTGLLHLL DEESNFPQAT NQTLLDKFKH QHEDNSYIEF PAVMEPAFII 650
    KHYAGKVKYG VKDFREKNTD HMRPDIVALL RSSKNAFISG MIGIDPVAVF 700
    RWAILRAFFR AMVAFREAGK RNIHRKTGHD DTAPCAILKS MDSFSFLQHP 750
    VHQRSLEILQ RCKEEKYSIT RKNPRTPLSD LQGMNALNEK NQHDTFDIAW 800
    NGRTGIRQSR LSSGTSLLDK DGIFANSTSS KLLERAHGIL TRNKNFKSKP 850
    ALPKHLLEVN SLKHLTRLTL QDRITKSLLH LHKKKKPPSI SAQFQASLSK 900
    LMETLGQAEP YFVKCIRSNA EKLPLRFSDV LVLRQLRYTG MLETVRIRQS 950
    GYSSKYSFQD FVSHFHVLLP RNIIPSKFNI QDFFRKINLN PDNYQVGKTM 1000
    VFLKEQERQH LQDLLHQEVL RRIILLQRWF RVLLCRQHFL HLRQASVIIQ 1050
    RFWRNYLNQK QVRDAAVQKD AFVMASAAAL LQASWRAHLE RQRYLELRAA 1100
    AIVIQQKWRD YYRRRHMAAI CIQARWKAYR ESKRYQEQRK KIILLQSTCR 1150
    GFRARQRFKA LKEQRLRETK PEVGLVNIKG YGSLEIQGSD PSGWEDCSFD 1200
    NRIKAIEECK SVIESNRISR ESSVDCLKES PNKQQERAQS QSGVDLQEDV 1250
    LVRERPRSLE DLHQKKVGRA KRESRRMREL EQAIFSLELL KVRSLGGISP 1300
    SEDRRWSTEL VPEGLQSPRG TPDSESSQGS LELLSYEESQ KSKLESVISD 1350
    EGDLQFPSPK ISSSPKFDSR DNALSASNET SSAEHLKDGT MKEMVVCSSE 1400
    SITCKPQLKD SFISNSLPTF FYIPQQDPLK TNSQLDTSIQ RNKLLENEDT 1450
    AGEALTLDIN RETRRYHCSG KDQIVPSLNT ESSNPVLKKL EKLNTEKEER 1500
    QKQLQQQNEK EMMEQIRQQT DILEKERKAF KTIEKPRIGE CLVAPSSYQS 1550
    KQRVERPSSL LSLNTSNKGE LNVLGSLSLK DAALAQKDSS SAHLPPKDRP 1600
    VTVFFERKGS PCQSSTVKEL SKTDRMGTQL NVACKLSNNR ISKREHFRPT 1650
    QSYSHNSDDL SREGNARPIF FTPKDNMSIP LVSKEALNSK NPQLHKEDEP 1700
    AWKPVKLAGP GQRETSQRFS SVDEQAKLHK TMSQGEITKL AVRQKASDSD 1750
    IRPQRAKMRF WAKGKQGEKK TTRVKPTTQS EVSPLFAGTD VIPAHQFPDE 1800
    LAAYHPTPPL SPELPGSCRK EFKENKEPSP KAKRKRSVKI SNVALDSMHW 1850
    QNDSVQIIAS VSDLKSMDEF LLKKVNDLDN EDSKKDTLVD VVFKKALKEF 1900
    RQNIFSFYSS ALAMDDGKSI RYKDLYALFE QILEKTMRLE QRDSLGESPV 1950
    RVWVNTFKVF LDEYMNEFKT SDCTATKVPK TERKKRRKKE TDLVEEHNGH 2000
    IFKATQYSIP TYCEYCSSLI WIMDRASVCK LCKYACHKKC CLKTTAKCSK 2050
    KYDPELSSRQ FGVELSRLTS EDRTVPLVVE KLINYIEMHG LYTEGIYRKS 2100
    GSTNKIKELR QGLDTDAESV NLDDYNIHVI ASVFKQWLRD LPNPLMTFEL 2150
    YEEFLRAMGL QERKETIRGV YSVIDQLSRT HLNTLERLIF HLVRIALQED 2200
    TNRMSANALA IVFAPCILRC PDTTDPLQSV QDISKTTTCV ELIVVEQMNK 2250
    YKARLKDISS LEFAENKAKT RLSLIRRSMG KGRIRRGNYP GPSSPVVVRL 2300
    PSVSDVSEET LTSEAAMETD ITEQQQAAMQ QEERVLTEQI ENLQKEKEEL 2350
    TFEMLVLEPR ASDDETLESE ASIGTADSSE NLNMESEYAI SEKSERSLAL 2400
    SSLKTAGKSE PSSKLRKQLK KQQDSLDVVD SSVSSLCLSN TASSHGTRKL 2450
    FQIYSKSPFY RAASGNEALG MEGPLGQTKF LEDKPQFISR GTFNPEKGKQ 2500
    KLKNVKNSPQ KTKETPEGTV MSGRRKTVDP DCTSNQQLAL FGNNEFMV 2548
    Length:2,548
    Mass (Da):292,706
    Last modified:May 18, 2010 - v2
    Checksum:i867835BD2B841C84
    GO
    Isoform 2 (identifier: B2RTY4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         367-385: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,529
    Mass (Da):290,379
    Checksum:i6024586FEA633B1C
    GO
    Isoform 3 (identifier: B2RTY4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         729-729: H → K
         730-2548: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:729
    Mass (Da):84,679
    Checksum:iC7529CD8EB711767
    GO
    Isoform 4 (identifier: B2RTY4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1714-1714: E → EVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEM

    Show »
    Length:2,619
    Mass (Da):300,433
    Checksum:iE19A84D21D057FB0
    GO
    Isoform 5 (identifier: B2RTY4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         45-280: Missing.

    Note: Lacks the ATP-binding domain which suggests that it cannot interact with actin.

    Show »
    Length:2,312
    Mass (Da):265,414
    Checksum:iD00A255132D264DC
    GO

    Sequence cautioni

    The sequence BAA91979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB14517.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti88 – 881L → R in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti94 – 941L → Q in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti104 – 1041R → H in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti206 – 2061H → R in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti394 – 3941D → N in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti424 – 4241S → P in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti504 – 5041S → C in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti573 – 5731E → D in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti595 – 5951C → Y in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti694 – 6941I → M in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti705 – 7051L → I in CAA04947. (PubMed:9819351)Curated
    Sequence conflicti1591 – 15911S → P in BAB14517. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti37 – 371R → K.1 Publication
    Corresponds to variant rs17855105 [ dbSNP | Ensembl ].
    VAR_046165
    Natural varianti85 – 851R → Q.1 Publication
    VAR_046166
    Natural varianti161 – 1611T → I.
    Corresponds to variant rs2929516 [ dbSNP | Ensembl ].
    VAR_046167
    Natural varianti168 – 1681N → D.1 Publication
    VAR_046168
    Natural varianti211 – 2111L → P.1 Publication
    VAR_046169
    Natural varianti825 – 8251A → V.
    Corresponds to variant rs11637562 [ dbSNP | Ensembl ].
    VAR_056189
    Natural varianti946 – 9461R → Q.1 Publication
    VAR_046170
    Natural varianti1193 – 11931G → E.4 Publications
    Corresponds to variant rs2415129 [ dbSNP | Ensembl ].
    VAR_046171
    Natural varianti1362 – 13621S → P.1 Publication
    Corresponds to variant rs55738821 [ dbSNP | Ensembl ].
    VAR_046172
    Natural varianti1476 – 14761P → R.
    Corresponds to variant rs16956375 [ dbSNP | Ensembl ].
    VAR_046173
    Natural varianti1795 – 17951H → Y.
    Corresponds to variant rs16956367 [ dbSNP | Ensembl ].
    VAR_046174
    Natural varianti1805 – 18051H → Q.
    Corresponds to variant rs2306575 [ dbSNP | Ensembl ].
    VAR_046175
    Natural varianti1834 – 18341R → C.1 Publication
    VAR_046176
    Natural varianti2390 – 23901I → V.
    Corresponds to variant rs2291280 [ dbSNP | Ensembl ].
    VAR_046177

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei45 – 280236Missing in isoform 5. 1 PublicationVSP_035156Add
    BLAST
    Alternative sequencei367 – 38519Missing in isoform 2. CuratedVSP_035157Add
    BLAST
    Alternative sequencei729 – 7291H → K in isoform 3. 1 PublicationVSP_035158
    Alternative sequencei730 – 25481819Missing in isoform 3. 1 PublicationVSP_035159Add
    BLAST
    Alternative sequencei1714 – 17141E → EVARPAHKKKARMARTRSDF LTRGTFADGEGDTEEDDYDD IIEPLLSLDQASHCELGPAP SLGQASHSDSEM in isoform 4. 2 PublicationsVSP_035160

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF117888 mRNA. Translation: AAD49195.1.
    AC020779 Genomic DNA. No translation available.
    AC022872 Genomic DNA. No translation available.
    AC090454 Genomic DNA. No translation available.
    AC104938 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77880.1.
    BC060886 mRNA. Translation: AAH60886.1.
    BC140869 mRNA. Translation: AAI40870.1.
    AJ001714 mRNA. Translation: CAA04947.1.
    AB290183 mRNA. Translation: BAG06737.1.
    L29148 mRNA. Translation: AAA20911.1.
    DQ088983 mRNA. Translation: AAZ85978.1.
    DQ088984 mRNA. Translation: AAZ85979.1.
    AL137287 mRNA. Translation: CAB70679.1.
    AK001923 mRNA. Translation: BAA91979.1. Different initiation.
    AK023306 mRNA. Translation: BAB14517.1. Different initiation.
    CCDSiCCDS10239.1. [B2RTY4-1]
    PIRiE59435.
    I61699.
    T46354.
    RefSeqiNP_008832.2. NM_006901.3. [B2RTY4-1]
    XP_006720602.1. XM_006720539.1. [B2RTY4-4]
    XP_006720603.1. XM_006720540.1. [B2RTY4-4]
    UniGeneiHs.513000.
    Hs.546268.
    Hs.733087.

    Genome annotation databases

    EnsembliENST00000356056; ENSP00000348349; ENSG00000066933. [B2RTY4-1]
    ENST00000424560; ENSP00000399162; ENSG00000066933. [B2RTY4-4]
    ENST00000444904; ENSP00000398250; ENSG00000066933. [B2RTY4-2]
    GeneIDi4649.
    KEGGihsa:4649.
    UCSCiuc002atl.5. human. [B2RTY4-1]
    uc002atn.1. human. [B2RTY4-4]
    uc002ato.4. human. [B2RTY4-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF117888 mRNA. Translation: AAD49195.1 .
    AC020779 Genomic DNA. No translation available.
    AC022872 Genomic DNA. No translation available.
    AC090454 Genomic DNA. No translation available.
    AC104938 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77880.1 .
    BC060886 mRNA. Translation: AAH60886.1 .
    BC140869 mRNA. Translation: AAI40870.1 .
    AJ001714 mRNA. Translation: CAA04947.1 .
    AB290183 mRNA. Translation: BAG06737.1 .
    L29148 mRNA. Translation: AAA20911.1 .
    DQ088983 mRNA. Translation: AAZ85978.1 .
    DQ088984 mRNA. Translation: AAZ85979.1 .
    AL137287 mRNA. Translation: CAB70679.1 .
    AK001923 mRNA. Translation: BAA91979.1 . Different initiation.
    AK023306 mRNA. Translation: BAB14517.1 . Different initiation.
    CCDSi CCDS10239.1. [B2RTY4-1 ]
    PIRi E59435.
    I61699.
    T46354.
    RefSeqi NP_008832.2. NM_006901.3. [B2RTY4-1 ]
    XP_006720602.1. XM_006720539.1. [B2RTY4-4 ]
    XP_006720603.1. XM_006720540.1. [B2RTY4-4 ]
    UniGenei Hs.513000.
    Hs.546268.
    Hs.733087.

    3D structure databases

    ProteinModelPortali B2RTY4.
    SMRi B2RTY4. Positions 145-1057, 1132-1162, 1993-2244.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110733. 5 interactions.
    IntActi B2RTY4. 5 interactions.
    MINTi MINT-1425451.

    Proteomic databases

    MaxQBi B2RTY4.
    PaxDbi B2RTY4.
    PeptideAtlasi Q14787.
    PRIDEi B2RTY4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000356056 ; ENSP00000348349 ; ENSG00000066933 . [B2RTY4-1 ]
    ENST00000424560 ; ENSP00000399162 ; ENSG00000066933 . [B2RTY4-4 ]
    ENST00000444904 ; ENSP00000398250 ; ENSG00000066933 . [B2RTY4-2 ]
    GeneIDi 4649.
    KEGGi hsa:4649.
    UCSCi uc002atl.5. human. [B2RTY4-1 ]
    uc002atn.1. human. [B2RTY4-4 ]
    uc002ato.4. human. [B2RTY4-3 ]

    Organism-specific databases

    CTDi 4649.
    GeneCardsi GC15M072114.
    H-InvDB HIX0012401.
    HGNCi HGNC:7608. MYO9A.
    HPAi HPA039812.
    HPA040071.
    MIMi 604875. gene.
    neXtProti NX_B2RTY4.
    PharmGKBi PA31413.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5022.
    HOVERGENi HBG108165.
    InParanoidi B2RTY4.
    KOi K10360.
    OMAi HGILMRN.
    OrthoDBi EOG7CK35Z.
    PhylomeDBi B2RTY4.
    TreeFami TF316834.

    Enzyme and pathway databases

    Reactomei REACT_11051. Rho GTPase cycle.

    Miscellaneous databases

    GenomeRNAii 4649.
    NextBioi 17924.
    PROi B2RTY4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi B2RTY4.
    Bgeei B2RTY4.
    Genevestigatori B2RTY4.

    Family and domain databases

    Gene3Di 1.10.555.10. 1 hit.
    InterProi IPR000048. IQ_motif_EF-hand-BS.
    IPR028558. MYO9A.
    IPR001609. Myosin_head_motor_dom.
    IPR027417. P-loop_NTPase.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR000159. Ras-assoc.
    IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    PANTHERi PTHR13140:SF9. PTHR13140:SF9. 1 hit.
    Pfami PF00612. IQ. 4 hits.
    PF00063. Myosin_head. 2 hits.
    PF00788. RA. 1 hit.
    PF00620. RhoGAP. 1 hit.
    [Graphical view ]
    PRINTSi PR00193. MYOSINHEAVY.
    SMARTi SM00109. C1. 1 hit.
    SM00015. IQ. 5 hits.
    SM00242. MYSc. 1 hit.
    SM00314. RA. 1 hit.
    SM00324. RhoGAP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48350. SSF48350. 1 hit.
    SSF52540. SSF52540. 3 hits.
    SSF54236. SSF54236. 1 hit.
    PROSITEi PS50096. IQ. 4 hits.
    PS51456. MYOSIN_MOTOR. 1 hit.
    PS50200. RA. 1 hit.
    PS50238. RHOGAP. 1 hit.
    PS00479. ZF_DAG_PE_1. 1 hit.
    PS50081. ZF_DAG_PE_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The cloning and developmental expression of unconventional myosin IXA (MYO9A) a gene in the Bardet-Biedl syndrome (BBS4) region at chromosome 15q22-q23."
      Gorman S.W., Haider N.B., Grieshammer U., Swiderski R.E., Kim E., Welch J.W., Searby C., Leng S., Carmi R., Sheffield V.C., Duhl D.M.
      Genomics 59:150-160(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), TISSUE SPECIFICITY, VARIANTS GLN-85; ASP-168; PRO-211; GLN-946; GLU-1193; PRO-1362 AND CYS-1834.
    2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1193.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS LYS-37 AND GLU-1193.
      Tissue: Placenta.
    5. "Myr 7 is a novel myosin IX-RhoGAP expressed in rat brain."
      Chieregatti E., Gaertner A., Stoeffler H.-E., Baehler M.
      J. Cell Sci. 111:3597-3608(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-774 (ISOFORMS 1/4).
    6. "Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins."
      Yamakawa H., Kikuno R.F., Nagase T., Ohara O.
      Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-2548 (ISOFORM 1), VARIANT GLU-1193.
      Tissue: Brain.
    7. "Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types."
      Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S.
      Proc. Natl. Acad. Sci. U.S.A. 91:6549-6553(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 234-322 (ISOFORMS 1/2/3/4).
    8. "Non-EST based prediction of exon skipping and intron retention events using Pfam information."
      Hiller M., Huse K., Platzer M., Backofen R.
      Nucleic Acids Res. 33:5611-5621(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 292-445 (ISOFORMS 1/2/3/4/5).
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1223-2548 (ISOFORM 4).
      Tissue: Testis.
    10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1457-1981 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1984-2548 (ISOFORMS 1/2/4/5).
      Tissue: Ovary and Placenta.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMYO9A_HUMAN
    AccessioniPrimary (citable) accession number: B2RTY4
    Secondary accession number(s): B0I1T5
    , C9IYB3, C9JA86, Q14787, Q3YLD7, Q3YLD8, Q6P986, Q9H8T5, Q9NTG2, Q9NUY2, Q9UEP3, Q9UNJ2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 2, 2008
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 67 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3