Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Unconventional myosin-IXa

Gene

MYO9A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi239 – 246ATPSequence analysis8
Zinc fingeri1999 – 2048Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri2068 – 2119Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd BLAST52

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation, Motor protein, Myosin

Keywords - Ligandi

Actin-binding, ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Unconventional myosin-IXa
Alternative name(s):
Unconventional myosin-9a
Gene namesi
Name:MYO9A
Synonyms:MYR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:7608. MYO9A.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei175 – 195HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • cytosol Source: Reactome
  • integral component of membrane Source: UniProtKB-KW
  • unconventional myosin complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4649.
OpenTargetsiENSG00000066933.
PharmGKBiPA31413.

Polymorphism and mutation databases

BioMutaiMYO9A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003484401 – 2548Unconventional myosin-IXaAdd BLAST2548

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei755PhosphoserineBy similarity1
Modified residuei1242PhosphoserineBy similarity1
Modified residuei1258PhosphoserineBy similarity1
Modified residuei1299PhosphoserineCombined sources1
Modified residuei1317PhosphoserineCombined sources1
Modified residuei1364PhosphoserineCombined sources1
Modified residuei1948PhosphoserineBy similarity1
Modified residuei2294PhosphoserineCombined sources1
Modified residuei2464PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiB2RTY4.
PaxDbiB2RTY4.
PRIDEiB2RTY4.

PTM databases

iPTMnetiB2RTY4.
PhosphoSitePlusiB2RTY4.

Expressioni

Tissue specificityi

Found to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver. Isoform 5 was found in leukocytes but not in brain, retina or testis.1 Publication

Gene expression databases

BgeeiENSG00000066933.
ExpressionAtlasiB2RTY4. baseline and differential.
GenevisibleiB2RTY4. HS.

Organism-specific databases

HPAiHPA039812.
HPA040071.

Interactioni

Protein-protein interaction databases

BioGridi110733. 22 interactors.
IntActiB2RTY4. 8 interactors.
MINTiMINT-1425451.
STRINGi9606.ENSP00000348349.

Structurei

3D structure databases

ProteinModelPortaliB2RTY4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini14 – 112Ras-associatingPROSITE-ProRule annotationAdd BLAST99
Domaini146 – 1016Myosin motorAdd BLAST871
Domaini1021 – 1041IQ 1PROSITE-ProRule annotationAdd BLAST21
Domaini1042 – 1071IQ 2PROSITE-ProRule annotationAdd BLAST30
Domaini1074 – 1103IQ 3PROSITE-ProRule annotationAdd BLAST30
Domaini1115 – 1144IQ 4PROSITE-ProRule annotationAdd BLAST30
Domaini1138 – 1167IQ 5PROSITE-ProRule annotationAdd BLAST30
Domaini2063 – 2251Rho-GAPPROSITE-ProRule annotationAdd BLAST189

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni907 – 918Actin-bindingBy similarityAdd BLAST12
Regioni1021 – 1162Neck or regulatory domainAdd BLAST142
Regioni1163 – 2511TailAdd BLAST1349

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1264 – 1291Sequence analysisAdd BLAST28
Coiled coili1486 – 1532Sequence analysisAdd BLAST47
Coiled coili2315 – 2358Sequence analysisAdd BLAST44

Sequence similaritiesi

Contains 5 IQ domains.PROSITE-ProRule annotation
Contains 1 myosin motor domain.Curated
Contains 2 phorbol-ester/DAG-type zinc fingers.PROSITE-ProRule annotation
Contains 1 Ras-associating domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1999 – 2048Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri2068 – 2119Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd BLAST52

Keywords - Domaini

Coiled coil, Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1453. Eukaryota.
KOG4229. Eukaryota.
COG5022. LUCA.
GeneTreeiENSGT00840000129687.
HOVERGENiHBG108165.
InParanoidiB2RTY4.
KOiK10360.
OMAiCKPQLRD.
OrthoDBiEOG091G003X.
PhylomeDBiB2RTY4.
TreeFamiTF316834.

Family and domain databases

CDDicd00029. C1. 1 hit.
Gene3Di1.10.555.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. PE/DAG-bd.
IPR000159. RA_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR13140:SF9. PTHR13140:SF9. 8 hits.
PfamiPF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50096. IQ. 4 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B2RTY4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNINDGGRRR FEDNEHTLRI YPGAISEGTI YCPIPARKNS TAAEVIESLI
60 70 80 90 100
NKLHLDKTKC YVLAEVKEFG GEEWILNPTD CPVQRMMLWP RMALENRLSG
110 120 130 140 150
EDYRFLLREK NLDGSIHYGS LQSWLRVTEE RRRMMERGFL PQPQQKDFDD
160 170 180 190 200
LCSLPDLNEK TLLENLRNRF KHEKIYTYVG SILIVINPFK FLPIYNPKYV
210 220 230 240 250
KMYDNHQLGK LEPHIYAVAD VAYHAMLQRK KNQCIVISGE SGSGKTQSTN
260 270 280 290 300
FLIHHLTALS QKGFASGVEQ IILGAGPVLE AFGNAKTAHN NNSSRFGKFI
310 320 330 340 350
QVNYQETGTV LGAYVEKYLL EKSRLVYQEH NERNYHVFYY LLAGASEDER
360 370 380 390 400
SAFHLKQPEE YHYLNQITKK PLRQSWDDYC YDSEPDCFTV EGEDLRHDFE
410 420 430 440 450
RLQLAMEMVG FLPKTRRQIF SLLSAILHLG NICYKKKTYR DDSIDICNPE
460 470 480 490 500
VLPIVSELLE VKEEMLFEAL VTRKTVTVGE KLILPYKLAE AVTVRNSMAK
510 520 530 540 550
SLYSALFDWI VFRINHALLN SKDLEHNTKT LSIGVLDIFG FEDYENNSFE
560 570 580 590 600
QFCINFANER LQHYFNQHIF KLEQEEYRTE GISWHNIDYI DNTCCINLIS
610 620 630 640 650
KKPTGLLHLL DEESNFPQAT NQTLLDKFKH QHEDNSYIEF PAVMEPAFII
660 670 680 690 700
KHYAGKVKYG VKDFREKNTD HMRPDIVALL RSSKNAFISG MIGIDPVAVF
710 720 730 740 750
RWAILRAFFR AMVAFREAGK RNIHRKTGHD DTAPCAILKS MDSFSFLQHP
760 770 780 790 800
VHQRSLEILQ RCKEEKYSIT RKNPRTPLSD LQGMNALNEK NQHDTFDIAW
810 820 830 840 850
NGRTGIRQSR LSSGTSLLDK DGIFANSTSS KLLERAHGIL TRNKNFKSKP
860 870 880 890 900
ALPKHLLEVN SLKHLTRLTL QDRITKSLLH LHKKKKPPSI SAQFQASLSK
910 920 930 940 950
LMETLGQAEP YFVKCIRSNA EKLPLRFSDV LVLRQLRYTG MLETVRIRQS
960 970 980 990 1000
GYSSKYSFQD FVSHFHVLLP RNIIPSKFNI QDFFRKINLN PDNYQVGKTM
1010 1020 1030 1040 1050
VFLKEQERQH LQDLLHQEVL RRIILLQRWF RVLLCRQHFL HLRQASVIIQ
1060 1070 1080 1090 1100
RFWRNYLNQK QVRDAAVQKD AFVMASAAAL LQASWRAHLE RQRYLELRAA
1110 1120 1130 1140 1150
AIVIQQKWRD YYRRRHMAAI CIQARWKAYR ESKRYQEQRK KIILLQSTCR
1160 1170 1180 1190 1200
GFRARQRFKA LKEQRLRETK PEVGLVNIKG YGSLEIQGSD PSGWEDCSFD
1210 1220 1230 1240 1250
NRIKAIEECK SVIESNRISR ESSVDCLKES PNKQQERAQS QSGVDLQEDV
1260 1270 1280 1290 1300
LVRERPRSLE DLHQKKVGRA KRESRRMREL EQAIFSLELL KVRSLGGISP
1310 1320 1330 1340 1350
SEDRRWSTEL VPEGLQSPRG TPDSESSQGS LELLSYEESQ KSKLESVISD
1360 1370 1380 1390 1400
EGDLQFPSPK ISSSPKFDSR DNALSASNET SSAEHLKDGT MKEMVVCSSE
1410 1420 1430 1440 1450
SITCKPQLKD SFISNSLPTF FYIPQQDPLK TNSQLDTSIQ RNKLLENEDT
1460 1470 1480 1490 1500
AGEALTLDIN RETRRYHCSG KDQIVPSLNT ESSNPVLKKL EKLNTEKEER
1510 1520 1530 1540 1550
QKQLQQQNEK EMMEQIRQQT DILEKERKAF KTIEKPRIGE CLVAPSSYQS
1560 1570 1580 1590 1600
KQRVERPSSL LSLNTSNKGE LNVLGSLSLK DAALAQKDSS SAHLPPKDRP
1610 1620 1630 1640 1650
VTVFFERKGS PCQSSTVKEL SKTDRMGTQL NVACKLSNNR ISKREHFRPT
1660 1670 1680 1690 1700
QSYSHNSDDL SREGNARPIF FTPKDNMSIP LVSKEALNSK NPQLHKEDEP
1710 1720 1730 1740 1750
AWKPVKLAGP GQRETSQRFS SVDEQAKLHK TMSQGEITKL AVRQKASDSD
1760 1770 1780 1790 1800
IRPQRAKMRF WAKGKQGEKK TTRVKPTTQS EVSPLFAGTD VIPAHQFPDE
1810 1820 1830 1840 1850
LAAYHPTPPL SPELPGSCRK EFKENKEPSP KAKRKRSVKI SNVALDSMHW
1860 1870 1880 1890 1900
QNDSVQIIAS VSDLKSMDEF LLKKVNDLDN EDSKKDTLVD VVFKKALKEF
1910 1920 1930 1940 1950
RQNIFSFYSS ALAMDDGKSI RYKDLYALFE QILEKTMRLE QRDSLGESPV
1960 1970 1980 1990 2000
RVWVNTFKVF LDEYMNEFKT SDCTATKVPK TERKKRRKKE TDLVEEHNGH
2010 2020 2030 2040 2050
IFKATQYSIP TYCEYCSSLI WIMDRASVCK LCKYACHKKC CLKTTAKCSK
2060 2070 2080 2090 2100
KYDPELSSRQ FGVELSRLTS EDRTVPLVVE KLINYIEMHG LYTEGIYRKS
2110 2120 2130 2140 2150
GSTNKIKELR QGLDTDAESV NLDDYNIHVI ASVFKQWLRD LPNPLMTFEL
2160 2170 2180 2190 2200
YEEFLRAMGL QERKETIRGV YSVIDQLSRT HLNTLERLIF HLVRIALQED
2210 2220 2230 2240 2250
TNRMSANALA IVFAPCILRC PDTTDPLQSV QDISKTTTCV ELIVVEQMNK
2260 2270 2280 2290 2300
YKARLKDISS LEFAENKAKT RLSLIRRSMG KGRIRRGNYP GPSSPVVVRL
2310 2320 2330 2340 2350
PSVSDVSEET LTSEAAMETD ITEQQQAAMQ QEERVLTEQI ENLQKEKEEL
2360 2370 2380 2390 2400
TFEMLVLEPR ASDDETLESE ASIGTADSSE NLNMESEYAI SEKSERSLAL
2410 2420 2430 2440 2450
SSLKTAGKSE PSSKLRKQLK KQQDSLDVVD SSVSSLCLSN TASSHGTRKL
2460 2470 2480 2490 2500
FQIYSKSPFY RAASGNEALG MEGPLGQTKF LEDKPQFISR GTFNPEKGKQ
2510 2520 2530 2540
KLKNVKNSPQ KTKETPEGTV MSGRRKTVDP DCTSNQQLAL FGNNEFMV
Length:2,548
Mass (Da):292,706
Last modified:May 18, 2010 - v2
Checksum:i867835BD2B841C84
GO
Isoform 2 (identifier: B2RTY4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-385: Missing.

Note: No experimental confirmation available.
Show »
Length:2,529
Mass (Da):290,379
Checksum:i6024586FEA633B1C
GO
Isoform 3 (identifier: B2RTY4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-729: H → K
     730-2548: Missing.

Note: No experimental confirmation available.
Show »
Length:729
Mass (Da):84,679
Checksum:iC7529CD8EB711767
GO
Isoform 4 (identifier: B2RTY4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1714-1714: E → EVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEM

Show »
Length:2,619
Mass (Da):300,433
Checksum:iE19A84D21D057FB0
GO
Isoform 5 (identifier: B2RTY4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-280: Missing.

Note: Lacks the ATP-binding domain which suggests that it cannot interact with actin.
Show »
Length:2,312
Mass (Da):265,414
Checksum:iD00A255132D264DC
GO

Sequence cautioni

The sequence BAA91979 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14517 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti88L → R in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti94L → Q in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti104R → H in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti206H → R in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti394D → N in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti424S → P in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti504S → C in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti573E → D in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti595C → Y in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti694I → M in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti705L → I in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti1591S → P in BAB14517 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04616537R → K.1 PublicationCorresponds to variant rs17855105dbSNPEnsembl.1
Natural variantiVAR_04616685R → Q.1 Publication1
Natural variantiVAR_046167161T → I.Corresponds to variant rs2929516dbSNPEnsembl.1
Natural variantiVAR_046168168N → D.1 Publication1
Natural variantiVAR_046169211L → P.1 Publication1
Natural variantiVAR_056189825A → V.Corresponds to variant rs11637562dbSNPEnsembl.1
Natural variantiVAR_046170946R → Q.1 PublicationCorresponds to variant rs754348944dbSNPEnsembl.1
Natural variantiVAR_0461711193G → E.4 PublicationsCorresponds to variant rs2415129dbSNPEnsembl.1
Natural variantiVAR_0461721362S → P.1 PublicationCorresponds to variant rs55738821dbSNPEnsembl.1
Natural variantiVAR_0461731476P → R.Corresponds to variant rs16956375dbSNPEnsembl.1
Natural variantiVAR_0461741795H → Y.Corresponds to variant rs16956367dbSNPEnsembl.1
Natural variantiVAR_0461751805H → Q.Corresponds to variant rs2306575dbSNPEnsembl.1
Natural variantiVAR_0461761834R → C.1 PublicationCorresponds to variant rs74475742dbSNPEnsembl.1
Natural variantiVAR_0461772390I → V.Corresponds to variant rs2291280dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03515645 – 280Missing in isoform 5. 1 PublicationAdd BLAST236
Alternative sequenceiVSP_035157367 – 385Missing in isoform 2. CuratedAdd BLAST19
Alternative sequenceiVSP_035158729H → K in isoform 3. 1 Publication1
Alternative sequenceiVSP_035159730 – 2548Missing in isoform 3. 1 PublicationAdd BLAST1819
Alternative sequenceiVSP_0351601714E → EVARPAHKKKARMARTRSDF LTRGTFADGEGDTEEDDYDD IIEPLLSLDQASHCELGPAP SLGQASHSDSEM in isoform 4. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF117888 mRNA. Translation: AAD49195.1.
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1.
BC060886 mRNA. Translation: AAH60886.1.
BC140869 mRNA. Translation: AAI40870.1.
AJ001714 mRNA. Translation: CAA04947.1.
AB290183 mRNA. Translation: BAG06737.1.
L29148 mRNA. Translation: AAA20911.1.
DQ088983 mRNA. Translation: AAZ85978.1.
DQ088984 mRNA. Translation: AAZ85979.1.
AL137287 mRNA. Translation: CAB70679.1.
AK001923 mRNA. Translation: BAA91979.1. Different initiation.
AK023306 mRNA. Translation: BAB14517.1. Different initiation.
CCDSiCCDS10239.1. [B2RTY4-1]
PIRiE59435.
I61699.
T46354.
RefSeqiNP_008832.2. NM_006901.3. [B2RTY4-1]
XP_006720602.1. XM_006720539.2. [B2RTY4-4]
UniGeneiHs.513000.
Hs.546268.
Hs.733087.

Genome annotation databases

EnsembliENST00000356056; ENSP00000348349; ENSG00000066933. [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933. [B2RTY4-3]
ENST00000444904; ENSP00000398250; ENSG00000066933. [B2RTY4-1]
GeneIDi4649.
KEGGihsa:4649.
UCSCiuc002atl.6. human. [B2RTY4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF117888 mRNA. Translation: AAD49195.1.
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1.
BC060886 mRNA. Translation: AAH60886.1.
BC140869 mRNA. Translation: AAI40870.1.
AJ001714 mRNA. Translation: CAA04947.1.
AB290183 mRNA. Translation: BAG06737.1.
L29148 mRNA. Translation: AAA20911.1.
DQ088983 mRNA. Translation: AAZ85978.1.
DQ088984 mRNA. Translation: AAZ85979.1.
AL137287 mRNA. Translation: CAB70679.1.
AK001923 mRNA. Translation: BAA91979.1. Different initiation.
AK023306 mRNA. Translation: BAB14517.1. Different initiation.
CCDSiCCDS10239.1. [B2RTY4-1]
PIRiE59435.
I61699.
T46354.
RefSeqiNP_008832.2. NM_006901.3. [B2RTY4-1]
XP_006720602.1. XM_006720539.2. [B2RTY4-4]
UniGeneiHs.513000.
Hs.546268.
Hs.733087.

3D structure databases

ProteinModelPortaliB2RTY4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110733. 22 interactors.
IntActiB2RTY4. 8 interactors.
MINTiMINT-1425451.
STRINGi9606.ENSP00000348349.

PTM databases

iPTMnetiB2RTY4.
PhosphoSitePlusiB2RTY4.

Polymorphism and mutation databases

BioMutaiMYO9A.

Proteomic databases

MaxQBiB2RTY4.
PaxDbiB2RTY4.
PRIDEiB2RTY4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356056; ENSP00000348349; ENSG00000066933. [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933. [B2RTY4-3]
ENST00000444904; ENSP00000398250; ENSG00000066933. [B2RTY4-1]
GeneIDi4649.
KEGGihsa:4649.
UCSCiuc002atl.6. human. [B2RTY4-1]

Organism-specific databases

CTDi4649.
DisGeNETi4649.
GeneCardsiMYO9A.
H-InvDBHIX0012401.
HGNCiHGNC:7608. MYO9A.
HPAiHPA039812.
HPA040071.
MIMi604875. gene.
neXtProtiNX_B2RTY4.
OpenTargetsiENSG00000066933.
PharmGKBiPA31413.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1453. Eukaryota.
KOG4229. Eukaryota.
COG5022. LUCA.
GeneTreeiENSGT00840000129687.
HOVERGENiHBG108165.
InParanoidiB2RTY4.
KOiK10360.
OMAiCKPQLRD.
OrthoDBiEOG091G003X.
PhylomeDBiB2RTY4.
TreeFamiTF316834.

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.

Miscellaneous databases

GenomeRNAii4649.
PROiB2RTY4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000066933.
ExpressionAtlasiB2RTY4. baseline and differential.
GenevisibleiB2RTY4. HS.

Family and domain databases

CDDicd00029. C1. 1 hit.
Gene3Di1.10.555.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. PE/DAG-bd.
IPR000159. RA_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR13140:SF9. PTHR13140:SF9. 8 hits.
PfamiPF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50096. IQ. 4 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYO9A_HUMAN
AccessioniPrimary (citable) accession number: B2RTY4
Secondary accession number(s): B0I1T5
, C9IYB3, C9JA86, Q14787, Q3YLD7, Q3YLD8, Q6P986, Q9H8T5, Q9NTG2, Q9NUY2, Q9UEP3, Q9UNJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Represents an unconventional myosin. This protein should not be confused with the conventional myosin-9 (MYH9).Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.