Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

B2RTY4 (MYO9A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 62. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Unconventional myosin-IXa
Alternative name(s):
Unconventional myosin-9a
Gene names
Name:MYO9A
Synonyms:MYR7
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2548 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function By similarity.

Subcellular location

Membrane; Single-pass membrane protein Potential.

Tissue specificity

Found to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver. Isoform 5 was found in leukocytes but not in brain, retina or testis. Ref.1

Sequence similarities

Contains 5 IQ domains.

Contains 2 myosin head-like domains.

Contains 2 phorbol-ester/DAG-type zinc fingers.

Contains 1 Ras-associating domain.

Contains 1 Rho-GAP domain.

Caution

Represents an unconventional myosin. This protein should not be confused with the conventional myosin-9 (MYH9).

Sequence caution

The sequence BAA91979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB14517.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: B2RTY4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: B2RTY4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     367-385: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: B2RTY4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     729-729: H → K
     730-2548: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: B2RTY4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1714-1714: E → EVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEM
Isoform 5 (identifier: B2RTY4-5)

The sequence of this isoform differs from the canonical sequence as follows:
     45-280: Missing.
Note: Lacks the ATP-binding domain which suggests that it cannot interact with actin.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 25482548Unconventional myosin-IXa
PRO_0000348440

Regions

Transmembrane175 – 19521Helical; Potential
Domain14 – 11299Ras-associating
Domain148 – 690543Myosin head-like 1
Domain884 – 1005122Myosin head-like 2
Domain1021 – 104121IQ 1
Domain1042 – 107130IQ 2
Domain1074 – 110330IQ 3
Domain1115 – 114430IQ 4
Domain1138 – 116730IQ 5
Domain2063 – 2251189Rho-GAP
Nucleotide binding239 – 2468ATP Potential
Zinc finger1999 – 204850Phorbol-ester/DAG-type 1
Zinc finger2068 – 211952Phorbol-ester/DAG-type 2
Region907 – 91812Actin-binding By similarity
Region1021 – 1162142Neck or regulatory domain
Region1163 – 25111349Tail
Coiled coil1264 – 129128 Potential
Coiled coil1486 – 153247 Potential
Coiled coil2315 – 235844 Potential

Natural variations

Alternative sequence45 – 280236Missing in isoform 5.
VSP_035156
Alternative sequence367 – 38519Missing in isoform 2.
VSP_035157
Alternative sequence7291H → K in isoform 3.
VSP_035158
Alternative sequence730 – 25481819Missing in isoform 3.
VSP_035159
Alternative sequence17141E → EVARPAHKKKARMARTRSDF LTRGTFADGEGDTEEDDYDD IIEPLLSLDQASHCELGPAP SLGQASHSDSEM in isoform 4.
VSP_035160
Natural variant371R → K. Ref.4
Corresponds to variant rs17855105 [ dbSNP | Ensembl ].
VAR_046165
Natural variant851R → Q. Ref.1
VAR_046166
Natural variant1611T → I.
Corresponds to variant rs2929516 [ dbSNP | Ensembl ].
VAR_046167
Natural variant1681N → D. Ref.1
VAR_046168
Natural variant2111L → P. Ref.1
VAR_046169
Natural variant8251A → V.
Corresponds to variant rs11637562 [ dbSNP | Ensembl ].
VAR_056189
Natural variant9461R → Q. Ref.1
VAR_046170
Natural variant11931G → E. Ref.1 Ref.3 Ref.4 Ref.6
Corresponds to variant rs2415129 [ dbSNP | Ensembl ].
VAR_046171
Natural variant13621S → P. Ref.1
Corresponds to variant rs55738821 [ dbSNP | Ensembl ].
VAR_046172
Natural variant14761P → R.
Corresponds to variant rs16956375 [ dbSNP | Ensembl ].
VAR_046173
Natural variant17951H → Y.
Corresponds to variant rs16956367 [ dbSNP | Ensembl ].
VAR_046174
Natural variant18051H → Q.
Corresponds to variant rs2306575 [ dbSNP | Ensembl ].
VAR_046175
Natural variant18341R → C. Ref.1
VAR_046176
Natural variant23901I → V.
Corresponds to variant rs2291280 [ dbSNP | Ensembl ].
VAR_046177

Experimental info

Sequence conflict881L → R in CAA04947. Ref.5
Sequence conflict941L → Q in CAA04947. Ref.5
Sequence conflict1041R → H in CAA04947. Ref.5
Sequence conflict2061H → R in CAA04947. Ref.5
Sequence conflict3941D → N in CAA04947. Ref.5
Sequence conflict4241S → P in CAA04947. Ref.5
Sequence conflict5041S → C in CAA04947. Ref.5
Sequence conflict5731E → D in CAA04947. Ref.5
Sequence conflict5951C → Y in CAA04947. Ref.5
Sequence conflict6941I → M in CAA04947. Ref.5
Sequence conflict7051L → I in CAA04947. Ref.5
Sequence conflict15911S → P in BAB14517. Ref.10

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 18, 2010. Version 2.
Checksum: 867835BD2B841C84

FASTA2,548292,706
        10         20         30         40         50         60 
MNINDGGRRR FEDNEHTLRI YPGAISEGTI YCPIPARKNS TAAEVIESLI NKLHLDKTKC 

        70         80         90        100        110        120 
YVLAEVKEFG GEEWILNPTD CPVQRMMLWP RMALENRLSG EDYRFLLREK NLDGSIHYGS 

       130        140        150        160        170        180 
LQSWLRVTEE RRRMMERGFL PQPQQKDFDD LCSLPDLNEK TLLENLRNRF KHEKIYTYVG 

       190        200        210        220        230        240 
SILIVINPFK FLPIYNPKYV KMYDNHQLGK LEPHIYAVAD VAYHAMLQRK KNQCIVISGE 

       250        260        270        280        290        300 
SGSGKTQSTN FLIHHLTALS QKGFASGVEQ IILGAGPVLE AFGNAKTAHN NNSSRFGKFI 

       310        320        330        340        350        360 
QVNYQETGTV LGAYVEKYLL EKSRLVYQEH NERNYHVFYY LLAGASEDER SAFHLKQPEE 

       370        380        390        400        410        420 
YHYLNQITKK PLRQSWDDYC YDSEPDCFTV EGEDLRHDFE RLQLAMEMVG FLPKTRRQIF 

       430        440        450        460        470        480 
SLLSAILHLG NICYKKKTYR DDSIDICNPE VLPIVSELLE VKEEMLFEAL VTRKTVTVGE 

       490        500        510        520        530        540 
KLILPYKLAE AVTVRNSMAK SLYSALFDWI VFRINHALLN SKDLEHNTKT LSIGVLDIFG 

       550        560        570        580        590        600 
FEDYENNSFE QFCINFANER LQHYFNQHIF KLEQEEYRTE GISWHNIDYI DNTCCINLIS 

       610        620        630        640        650        660 
KKPTGLLHLL DEESNFPQAT NQTLLDKFKH QHEDNSYIEF PAVMEPAFII KHYAGKVKYG 

       670        680        690        700        710        720 
VKDFREKNTD HMRPDIVALL RSSKNAFISG MIGIDPVAVF RWAILRAFFR AMVAFREAGK 

       730        740        750        760        770        780 
RNIHRKTGHD DTAPCAILKS MDSFSFLQHP VHQRSLEILQ RCKEEKYSIT RKNPRTPLSD 

       790        800        810        820        830        840 
LQGMNALNEK NQHDTFDIAW NGRTGIRQSR LSSGTSLLDK DGIFANSTSS KLLERAHGIL 

       850        860        870        880        890        900 
TRNKNFKSKP ALPKHLLEVN SLKHLTRLTL QDRITKSLLH LHKKKKPPSI SAQFQASLSK 

       910        920        930        940        950        960 
LMETLGQAEP YFVKCIRSNA EKLPLRFSDV LVLRQLRYTG MLETVRIRQS GYSSKYSFQD 

       970        980        990       1000       1010       1020 
FVSHFHVLLP RNIIPSKFNI QDFFRKINLN PDNYQVGKTM VFLKEQERQH LQDLLHQEVL 

      1030       1040       1050       1060       1070       1080 
RRIILLQRWF RVLLCRQHFL HLRQASVIIQ RFWRNYLNQK QVRDAAVQKD AFVMASAAAL 

      1090       1100       1110       1120       1130       1140 
LQASWRAHLE RQRYLELRAA AIVIQQKWRD YYRRRHMAAI CIQARWKAYR ESKRYQEQRK 

      1150       1160       1170       1180       1190       1200 
KIILLQSTCR GFRARQRFKA LKEQRLRETK PEVGLVNIKG YGSLEIQGSD PSGWEDCSFD 

      1210       1220       1230       1240       1250       1260 
NRIKAIEECK SVIESNRISR ESSVDCLKES PNKQQERAQS QSGVDLQEDV LVRERPRSLE 

      1270       1280       1290       1300       1310       1320 
DLHQKKVGRA KRESRRMREL EQAIFSLELL KVRSLGGISP SEDRRWSTEL VPEGLQSPRG 

      1330       1340       1350       1360       1370       1380 
TPDSESSQGS LELLSYEESQ KSKLESVISD EGDLQFPSPK ISSSPKFDSR DNALSASNET 

      1390       1400       1410       1420       1430       1440 
SSAEHLKDGT MKEMVVCSSE SITCKPQLKD SFISNSLPTF FYIPQQDPLK TNSQLDTSIQ 

      1450       1460       1470       1480       1490       1500 
RNKLLENEDT AGEALTLDIN RETRRYHCSG KDQIVPSLNT ESSNPVLKKL EKLNTEKEER 

      1510       1520       1530       1540       1550       1560 
QKQLQQQNEK EMMEQIRQQT DILEKERKAF KTIEKPRIGE CLVAPSSYQS KQRVERPSSL 

      1570       1580       1590       1600       1610       1620 
LSLNTSNKGE LNVLGSLSLK DAALAQKDSS SAHLPPKDRP VTVFFERKGS PCQSSTVKEL 

      1630       1640       1650       1660       1670       1680 
SKTDRMGTQL NVACKLSNNR ISKREHFRPT QSYSHNSDDL SREGNARPIF FTPKDNMSIP 

      1690       1700       1710       1720       1730       1740 
LVSKEALNSK NPQLHKEDEP AWKPVKLAGP GQRETSQRFS SVDEQAKLHK TMSQGEITKL 

      1750       1760       1770       1780       1790       1800 
AVRQKASDSD IRPQRAKMRF WAKGKQGEKK TTRVKPTTQS EVSPLFAGTD VIPAHQFPDE 

      1810       1820       1830       1840       1850       1860 
LAAYHPTPPL SPELPGSCRK EFKENKEPSP KAKRKRSVKI SNVALDSMHW QNDSVQIIAS 

      1870       1880       1890       1900       1910       1920 
VSDLKSMDEF LLKKVNDLDN EDSKKDTLVD VVFKKALKEF RQNIFSFYSS ALAMDDGKSI 

      1930       1940       1950       1960       1970       1980 
RYKDLYALFE QILEKTMRLE QRDSLGESPV RVWVNTFKVF LDEYMNEFKT SDCTATKVPK 

      1990       2000       2010       2020       2030       2040 
TERKKRRKKE TDLVEEHNGH IFKATQYSIP TYCEYCSSLI WIMDRASVCK LCKYACHKKC 

      2050       2060       2070       2080       2090       2100 
CLKTTAKCSK KYDPELSSRQ FGVELSRLTS EDRTVPLVVE KLINYIEMHG LYTEGIYRKS 

      2110       2120       2130       2140       2150       2160 
GSTNKIKELR QGLDTDAESV NLDDYNIHVI ASVFKQWLRD LPNPLMTFEL YEEFLRAMGL 

      2170       2180       2190       2200       2210       2220 
QERKETIRGV YSVIDQLSRT HLNTLERLIF HLVRIALQED TNRMSANALA IVFAPCILRC 

      2230       2240       2250       2260       2270       2280 
PDTTDPLQSV QDISKTTTCV ELIVVEQMNK YKARLKDISS LEFAENKAKT RLSLIRRSMG 

      2290       2300       2310       2320       2330       2340 
KGRIRRGNYP GPSSPVVVRL PSVSDVSEET LTSEAAMETD ITEQQQAAMQ QEERVLTEQI 

      2350       2360       2370       2380       2390       2400 
ENLQKEKEEL TFEMLVLEPR ASDDETLESE ASIGTADSSE NLNMESEYAI SEKSERSLAL 

      2410       2420       2430       2440       2450       2460 
SSLKTAGKSE PSSKLRKQLK KQQDSLDVVD SSVSSLCLSN TASSHGTRKL FQIYSKSPFY 

      2470       2480       2490       2500       2510       2520 
RAASGNEALG MEGPLGQTKF LEDKPQFISR GTFNPEKGKQ KLKNVKNSPQ KTKETPEGTV 

      2530       2540 
MSGRRKTVDP DCTSNQQLAL FGNNEFMV 

« Hide

Isoform 2 [UniParc].

Checksum: 6024586FEA633B1C
Show »

FASTA2,529290,379
Isoform 3 [UniParc].

Checksum: C7529CD8EB711767
Show »

FASTA72984,679
Isoform 4 [UniParc].

Checksum: E19A84D21D057FB0
Show »

FASTA2,619300,433
Isoform 5 [UniParc].

Checksum: D00A255132D264DC
Show »

FASTA2,312265,414

References

« Hide 'large scale' references
[1]"The cloning and developmental expression of unconventional myosin IXA (MYO9A) a gene in the Bardet-Biedl syndrome (BBS4) region at chromosome 15q22-q23."
Gorman S.W., Haider N.B., Grieshammer U., Swiderski R.E., Kim E., Welch J.W., Searby C., Leng S., Carmi R., Sheffield V.C., Duhl D.M.
Genomics 59:150-160(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), TISSUE SPECIFICITY, VARIANTS GLN-85; ASP-168; PRO-211; GLN-946; GLU-1193; PRO-1362 AND CYS-1834.
[2]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1193.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS LYS-37 AND GLU-1193.
Tissue: Placenta.
[5]"Myr 7 is a novel myosin IX-RhoGAP expressed in rat brain."
Chieregatti E., Gaertner A., Stoeffler H.-E., Baehler M.
J. Cell Sci. 111:3597-3608(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-774 (ISOFORMS 1/4).
[6]"Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins."
Yamakawa H., Kikuno R.F., Nagase T., Ohara O.
Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-2548 (ISOFORM 1), VARIANT GLU-1193.
Tissue: Brain.
[7]"Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types."
Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S.
Proc. Natl. Acad. Sci. U.S.A. 91:6549-6553(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 234-322 (ISOFORMS 1/2/3/4).
[8]"Non-EST based prediction of exon skipping and intron retention events using Pfam information."
Hiller M., Huse K., Platzer M., Backofen R.
Nucleic Acids Res. 33:5611-5621(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 292-445 (ISOFORMS 1/2/3/4/5).
[9]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1223-2548 (ISOFORM 4).
Tissue: Testis.
[10]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1457-1981 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1984-2548 (ISOFORMS 1/2/4/5).
Tissue: Ovary and Placenta.
[11]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF117888 mRNA. Translation: AAD49195.1.
AC020779 Genomic DNA. No translation available.
AC022872 Genomic DNA. No translation available.
AC090454 Genomic DNA. No translation available.
AC104938 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77880.1.
BC060886 mRNA. Translation: AAH60886.1.
BC140869 mRNA. Translation: AAI40870.1.
AJ001714 mRNA. Translation: CAA04947.1.
AB290183 mRNA. Translation: BAG06737.1.
L29148 mRNA. Translation: AAA20911.1.
DQ088983 mRNA. Translation: AAZ85978.1.
DQ088984 mRNA. Translation: AAZ85979.1.
AL137287 mRNA. Translation: CAB70679.1.
AK001923 mRNA. Translation: BAA91979.1. Different initiation.
AK023306 mRNA. Translation: BAB14517.1. Different initiation.
PIRE59435.
I61699.
T46354.
RefSeqNP_008832.2. NM_006901.3.
UniGeneHs.513000.
Hs.546268.
Hs.733087.

3D structure databases

ProteinModelPortalB2RTY4.
SMRB2RTY4. Positions 14-1114, 1116-1164, 1951-2247.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110733. 5 interactions.
IntActB2RTY4. 5 interactions.
MINTMINT-1425451.

Proteomic databases

PaxDbB2RTY4.
PeptideAtlasQ14787.
PRIDEB2RTY4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000356056; ENSP00000348349; ENSG00000066933. [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933. [B2RTY4-4]
ENST00000444904; ENSP00000398250; ENSG00000066933. [B2RTY4-2]
GeneID4649.
KEGGhsa:4649.
UCSCuc002atl.5. human. [B2RTY4-1]
uc002atn.1. human. [B2RTY4-4]
uc002ato.4. human. [B2RTY4-3]

Organism-specific databases

CTD4649.
GeneCardsGC15M072114.
H-InvDBHIX0012401.
HGNCHGNC:7608. MYO9A.
HPAHPA039812.
HPA040071.
MIM604875. gene.
neXtProtNX_B2RTY4.
PharmGKBPA31413.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5022.
HOVERGENHBG108165.
InParanoidB2RTY4.
KOK10360.
OMAHGILMRN.
OrthoDBEOG7CK35Z.
PhylomeDBB2RTY4.
TreeFamTF316834.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressB2RTY4.
BgeeB2RTY4.
GenevestigatorB2RTY4.

Family and domain databases

Gene3D1.10.555.10. 1 hit.
InterProIPR000048. IQ_motif_EF-hand-BS.
IPR028558. MYO9A.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PANTHERPTHR13140:SF182. PTHR13140:SF182. 1 hit.
PfamPF00612. IQ. 4 hits.
PF00063. Myosin_head. 2 hits.
PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
PRINTSPR00193. MYOSINHEAVY.
SMARTSM00109. C1. 1 hit.
SM00015. IQ. 5 hits.
SM00242. MYSc. 1 hit.
SM00314. RA. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMSSF48350. SSF48350. 1 hit.
SSF52540. SSF52540. 3 hits.
PROSITEPS50096. IQ. 4 hits.
PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi4649.
NextBio17924.
PROB2RTY4.
SOURCESearch...

Entry information

Entry nameMYO9A_HUMAN
AccessionPrimary (citable) accession number: B2RTY4
Secondary accession number(s): B0I1T5 expand/collapse secondary AC list , C9IYB3, C9JA86, Q14787, Q3YLD7, Q3YLD8, Q6P986, Q9H8T5, Q9NTG2, Q9NUY2, Q9UEP3, Q9UNJ2
Entry history
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: May 18, 2010
Last modified: April 16, 2014
This is version 62 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM