B1AZP2 (DLGP4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
October 19, 2011.
Version 37.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large-associated protein 4 Short name=DAP-4 Alternative name(s): PSD-95/SAP90-binding protein 4 SAP90/PSD-95-associated protein 4 Short name=SAPAP-4 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 992 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane By similarity. |
| Subunit structure | Interacts with DLG1 and DLG4/PSD-95 By similarity. |
| Subcellular location | Membrane; Peripheral membrane protein By similarity. |
| Sequence similarities | Belongs to the SAPAP family. |
| Sequence caution | The sequence BAC65690.2 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell-cell signaling Inferred from electronic annotation. Source: InterPro |
| Cellular component | synapse Inferred from direct assay Ref.1. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: B1AZP2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: B1AZP2-2) The sequence of this isoform differs from the canonical sequence as follows: 671-700: VDCIQPVPKEEPSPATKFQSIGIQVEDDWR → ERTRRSGSHLSEDNGPKAIDVMAPSSE | ||||||
| Isoform 3 (identifier: B1AZP2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-539: Missing. 540-550: GSLSNSRTLPS → MALCLELLKQC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 992 | 992 | Disks large-associated protein 4 | PRO_0000345018 | |||||
Amino acid modifications | |||||||||
| Modified residue | 367 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 368 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 377 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 397 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 421 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 512 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 665 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 915 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 973 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 984 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 539 | 539 | Missing in isoform 3. | VSP_034907 | |||||
| Alternative sequence | 540 – 550 | 11 | GSLSNSRTLPS → MALCLELLKQC in isoform 3. | VSP_034908 | |||||
| Alternative sequence | 671 – 700 | 30 | VDCIQ…EDDWR → ERTRRSGSHLSEDNGPKAID VMAPSSE in isoform 2. | VSP_034909 | |||||
Experimental info | |||||||||
| Sequence conflict | 614 | 1 | S → N in AAH24558. Ref.4 | ||||||
| Sequence conflict | 676 | 1 | Missing in AAO89220. Ref.1 | ||||||
| Sequence conflict | 689 | 1 | Q → E in AAO89220. Ref.1 | ||||||
| Sequence conflict | 693 | 1 | I → V in AAO89220. Ref.1 | ||||||
| Sequence conflict | 693 | 1 | I → V in AAH24558. Ref.4 | ||||||
| Sequence conflict | 693 | 1 | I → V in AAI06095. Ref.4 | ||||||
| Sequence conflict | 774 | 1 | A → V in AAH24558. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential mRNA expression and protein localization of the SAP90/PSD-95-associated proteins (SAPAPs) in the nervous system of the mouse." Welch J.M., Wang D., Feng G. J. Comp. Neurol. 472:24-39(2004) [PubMed: 15024750] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: ICR. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed: 12693553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: C57BL/6, FVB/N and FVB/N-3. Tissue: Brain and Mammary tumor. |
| [5] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed: 15345747] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-973, MASS SPECTROMETRY. Tissue: Embryonic brain. |
| [6] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed: 16452087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-367; SER-377; SER-397 AND SER-512, MASS SPECTROMETRY. Tissue: Brain. |
| [7] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-421 AND THR-915, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [8] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed: 19367708] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-665, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK122408 Transcribed RNA. Translation: BAC65690.2. Sequence problems. AY243849 mRNA. Translation: AAO89220.2. BX004793, BX571766 Genomic DNA. Translation: CAM16917.1. BX571766, BX004793 Genomic DNA. Translation: CAM22345.1. BX004793, BX571766 Genomic DNA. Translation: CAM16918.1. BX571766, BX004793 Genomic DNA. Translation: CAM22346.1. BX004793, BX571766 Genomic DNA. Translation: CAM16919.1. BX571766, BX004793 Genomic DNA. Translation: CAM22347.1. BC024558 mRNA. Translation: AAH24558.1. BC058948 mRNA. Translation: AAH58948.1. BC085475 mRNA. Translation: AAH85475.1. BC106094 mRNA. Translation: AAI06095.1. BC141110 mRNA. Translation: AAI41111.1. BC145394 mRNA. Translation: AAI45395.1. |
| IPI | IPI00330186. IPI00377469. IPI00752220. |
| RefSeq | NP_001035952.1. NM_001042487.1. NP_001035953.1. NM_001042488.1. NP_666240.4. NM_146128.5. |
| UniGene | Mm.22094. |
3D structure databases | |
| ProteinModelPortal | B1AZP2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | B1AZP2. 2 interactions. |
| STRING | B1AZP2. |
PTM databases | |
| PhosphoSite | B1AZP2. |
Proteomic databases | |
| PRIDE | B1AZP2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000000094; ENSMUSP00000000094; ENSMUSG00000061689. ENSMUST00000070782; ENSMUSP00000068745; ENSMUSG00000061689. ENSMUST00000099145; ENSMUSP00000096749; ENSMUSG00000061689. ENSMUST00000109567; ENSMUSP00000105195; ENSMUSG00000061689. ENSMUST00000169464; ENSMUSP00000126980; ENSMUSG00000061689. |
| GeneID | 228836. |
| KEGG | mmu:228836. |
| UCSC | uc008nnr.1. mouse. uc008nnt.1. mouse. uc012chv.1. mouse. |
Organism-specific databases | |
| CTD | 22839. |
| MGI | MGI:2138865. Dlgap4. |
| Rouge | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00550000074473. |
| HOVERGEN | HBG018957. |
| InParanoid | B1AZP2. |
| OMA | EGPIPCR. |
| OrthoDB | EOG4ZCT3Z. |
| PhylomeDB | B1AZP2. |
Gene expression databases | |
| Bgee | B1AZP2. |
| Genevestigator | B1AZP2. |
Family and domain databases | |
| InterPro | IPR005026. GKAP. [Graphical view] |
| Pfam | PF03359. GKAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 379186. |
| SOURCE | Search... |
Entry information
| Entry name | DLGP4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: B1AZP2 Secondary accession number(s): B1AZP3 Q8R3U9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with