Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large-associated protein 4

Gene

Dlgap4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large-associated protein 4
Short name:
DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name:
SAPAP-4
Gene namesi
Name:Dlgap4
Synonyms:Kiaa0964, Sapap4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2138865. Dlgap4.

Subcellular locationi

GO - Cellular componenti

  • membrane Source: UniProtKB-SubCell
  • synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 992992Disks large-associated protein 4PRO_0000345018Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei206 – 2061PhosphoserineBy similarity
Modified residuei207 – 2071PhosphoserineCombined sources
Modified residuei377 – 3771PhosphoserineCombined sources
Modified residuei380 – 3801PhosphoserineBy similarity
Modified residuei384 – 3841PhosphoserineCombined sources
Modified residuei388 – 3881PhosphoserineCombined sources
Modified residuei405 – 4051PhosphoserineCombined sources
Modified residuei415 – 4151PhosphoserineCombined sources
Modified residuei421 – 4211PhosphoserineCombined sources
Modified residuei580 – 5801PhosphoserineCombined sources
Modified residuei581 – 5811PhosphoserineCombined sources
Modified residuei609 – 6091PhosphoserineCombined sources
Modified residuei611 – 6111PhosphoserineCombined sources
Modified residuei665 – 6651PhosphoserineCombined sources
Modified residuei744 – 7441PhosphoserineCombined sources
Modified residuei915 – 9151PhosphothreonineCombined sources
Modified residuei973 – 9731PhosphoserineCombined sources
Modified residuei977 – 9771PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiB1AZP2.
MaxQBiB1AZP2.
PaxDbiB1AZP2.
PRIDEiB1AZP2.

PTM databases

iPTMnetiB1AZP2.
PhosphoSiteiB1AZP2.

Expressioni

Gene expression databases

BgeeiB1AZP2.
ExpressionAtlasiB1AZP2. baseline and differential.
GenevisibleiB1AZP2. MM.

Interactioni

Subunit structurei

Interacts with DLG1 and DLG4/PSD-95.By similarity

Protein-protein interaction databases

BioGridi230780. 7 interactions.
IntActiB1AZP2. 10 interactions.
MINTiMINT-1616160.
STRINGi10090.ENSMUSP00000126980.

Structurei

3D structure databases

ProteinModelPortaliB1AZP2.
SMRiB1AZP2. Positions 803-908.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

eggNOGiKOG3971. Eukaryota.
ENOG4111JKV. LUCA.
GeneTreeiENSGT00550000074473.
HOVERGENiHBG018957.
InParanoidiB1AZP2.
OMAiPSWEEDY.
OrthoDBiEOG75QR37.
PhylomeDBiB1AZP2.
TreeFamiTF321382.

Family and domain databases

InterProiIPR030527. DLGAP4.
IPR005026. SAPAP.
[Graphical view]
PANTHERiPTHR12353:SF19. PTHR12353:SF19. 2 hits.
PfamiPF03359. GKAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B1AZP2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKGLGDSRPR HLSDSLDPPH EPLFAGPDRN PYLLSPTEAF AREARFPGQN
60 70 80 90 100
TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL
110 120 130 140 150
PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF
160 170 180 190 200
FTKAPSMEGT AGKVGGNGSK KGGLEDGKGR RAKSKERAKA GEPKRRSRSN
210 220 230 240 250
ISGWWSSDDN LDGEGGAFRS GPASGLMTLG RQQERTQPRY FMHAYNTISG
260 270 280 290 300
HMLKTTKNTT TELTAPPPPP APPATCPSLG VGTDTNYVKR GSWSTLTLSH
310 320 330 340 350
AHEVCQKTSA TLDKSLLKSK SCHQGLAYHY LQVPGGGGEW STTLLSPRDM
360 370 380 390 400
DSTAEGPIPC RRMRSGSYIK AMGDEDSDES GGGSPKPSPK TAARRQSYLR
410 420 430 440 450
ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEDDYNPI SDSLNDSSCI
460 470 480 490 500
SQVFGQASLI PQLFGHDQQV READLSDQYE AACESACSEA ESTTAEALDL
510 520 530 540 550
PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS
560 570 580 590 600
SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT
610 620 630 640 650
SQSGLSNSSD SLDSSTRPPS VTRGGITPGP EAPEPPPKHA ALKSEQGTLT
660 670 680 690 700
SSESHSEAIP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGIQVEDDWR
710 720 730 740 750
SSAPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTSHP NSISIDAGPR
760 770 780 790 800
QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC
810 820 830 840 850
RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ
860 870 880 890 900
LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD
910 920 930 940 950
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKAAV SRDKASDAGD
960 970 980 990
KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL
Length:992
Mass (Da):108,037
Last modified:April 8, 2008 - v1
Checksum:iA33016920922ABB9
GO
Isoform 2 (identifier: B1AZP2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGIQVEDDWR → ERTRRSGSHLSEDNGPKAIDVMAPSSE

Show »
Length:989
Mass (Da):107,551
Checksum:iFC0D22EB3BD0C09F
GO
Isoform 3 (identifier: B1AZP2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Show »
Length:453
Mass (Da):49,460
Checksum:iF631D60B5FB7D916
GO

Sequence cautioni

The sequence BAC65690.2 differs from that shown.Intron retention.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti614 – 6141S → N in AAH24558 (PubMed:15489334).Curated
Sequence conflicti676 – 6761Missing in AAO89220 (PubMed:15024750).Curated
Sequence conflicti689 – 6891Q → E in AAO89220 (PubMed:15024750).Curated
Sequence conflicti693 – 6931I → V in AAO89220 (PubMed:15024750).Curated
Sequence conflicti693 – 6931I → V in AAH24558 (PubMed:15489334).Curated
Sequence conflicti693 – 6931I → V in AAI06095 (PubMed:15489334).Curated
Sequence conflicti774 – 7741A → V in AAH24558 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 539539Missing in isoform 3. 1 PublicationVSP_034907Add
BLAST
Alternative sequencei540 – 55011GSLSNSRTLPS → MALCLELLKQC in isoform 3. 1 PublicationVSP_034908Add
BLAST
Alternative sequencei671 – 70030VDCIQ…EDDWR → ERTRRSGSHLSEDNGPKAID VMAPSSE in isoform 2. 2 PublicationsVSP_034909Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122408 Transcribed RNA. Translation: BAC65690.2. Sequence problems.
AY243849 mRNA. Translation: AAO89220.2.
BX004793, BX571766 Genomic DNA. Translation: CAM16917.1.
BX571766, BX004793 Genomic DNA. Translation: CAM22345.1.
BX004793, BX571766 Genomic DNA. Translation: CAM16918.1.
BX571766, BX004793 Genomic DNA. Translation: CAM22346.1.
BX004793, BX571766 Genomic DNA. Translation: CAM16919.1.
BX571766, BX004793 Genomic DNA. Translation: CAM22347.1.
BC024558 mRNA. Translation: AAH24558.1.
BC058948 mRNA. Translation: AAH58948.1.
BC085475 mRNA. Translation: AAH85475.1.
BC106094 mRNA. Translation: AAI06095.1.
BC141110 mRNA. Translation: AAI41111.1.
BC145394 mRNA. Translation: AAI45395.1.
CCDSiCCDS16968.1. [B1AZP2-1]
CCDS38299.1. [B1AZP2-3]
CCDS71171.1. [B1AZP2-2]
RefSeqiNP_001035952.1. NM_001042487.1. [B1AZP2-3]
NP_001035953.1. NM_001042488.2.
NP_001264115.1. NM_001277186.1. [B1AZP2-2]
NP_001264116.1. NM_001277187.1.
NP_666240.4. NM_146128.6. [B1AZP2-1]
XP_006499403.1. XM_006499340.2. [B1AZP2-1]
UniGeneiMm.22094.
Mm.491757.

Genome annotation databases

EnsembliENSMUST00000070782; ENSMUSP00000068745; ENSMUSG00000061689. [B1AZP2-2]
ENSMUST00000099145; ENSMUSP00000096749; ENSMUSG00000061689. [B1AZP2-3]
ENSMUST00000109567; ENSMUSP00000105195; ENSMUSG00000061689. [B1AZP2-2]
ENSMUST00000169464; ENSMUSP00000126980; ENSMUSG00000061689. [B1AZP2-1]
GeneIDi228836.
KEGGimmu:228836.
UCSCiuc008nnr.2. mouse. [B1AZP2-1]
uc008nnv.1. mouse. [B1AZP2-3]
uc012chv.2. mouse. [B1AZP2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122408 Transcribed RNA. Translation: BAC65690.2. Sequence problems.
AY243849 mRNA. Translation: AAO89220.2.
BX004793, BX571766 Genomic DNA. Translation: CAM16917.1.
BX571766, BX004793 Genomic DNA. Translation: CAM22345.1.
BX004793, BX571766 Genomic DNA. Translation: CAM16918.1.
BX571766, BX004793 Genomic DNA. Translation: CAM22346.1.
BX004793, BX571766 Genomic DNA. Translation: CAM16919.1.
BX571766, BX004793 Genomic DNA. Translation: CAM22347.1.
BC024558 mRNA. Translation: AAH24558.1.
BC058948 mRNA. Translation: AAH58948.1.
BC085475 mRNA. Translation: AAH85475.1.
BC106094 mRNA. Translation: AAI06095.1.
BC141110 mRNA. Translation: AAI41111.1.
BC145394 mRNA. Translation: AAI45395.1.
CCDSiCCDS16968.1. [B1AZP2-1]
CCDS38299.1. [B1AZP2-3]
CCDS71171.1. [B1AZP2-2]
RefSeqiNP_001035952.1. NM_001042487.1. [B1AZP2-3]
NP_001035953.1. NM_001042488.2.
NP_001264115.1. NM_001277186.1. [B1AZP2-2]
NP_001264116.1. NM_001277187.1.
NP_666240.4. NM_146128.6. [B1AZP2-1]
XP_006499403.1. XM_006499340.2. [B1AZP2-1]
UniGeneiMm.22094.
Mm.491757.

3D structure databases

ProteinModelPortaliB1AZP2.
SMRiB1AZP2. Positions 803-908.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi230780. 7 interactions.
IntActiB1AZP2. 10 interactions.
MINTiMINT-1616160.
STRINGi10090.ENSMUSP00000126980.

PTM databases

iPTMnetiB1AZP2.
PhosphoSiteiB1AZP2.

Proteomic databases

EPDiB1AZP2.
MaxQBiB1AZP2.
PaxDbiB1AZP2.
PRIDEiB1AZP2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070782; ENSMUSP00000068745; ENSMUSG00000061689. [B1AZP2-2]
ENSMUST00000099145; ENSMUSP00000096749; ENSMUSG00000061689. [B1AZP2-3]
ENSMUST00000109567; ENSMUSP00000105195; ENSMUSG00000061689. [B1AZP2-2]
ENSMUST00000169464; ENSMUSP00000126980; ENSMUSG00000061689. [B1AZP2-1]
GeneIDi228836.
KEGGimmu:228836.
UCSCiuc008nnr.2. mouse. [B1AZP2-1]
uc008nnv.1. mouse. [B1AZP2-3]
uc012chv.2. mouse. [B1AZP2-2]

Organism-specific databases

CTDi22839.
MGIiMGI:2138865. Dlgap4.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3971. Eukaryota.
ENOG4111JKV. LUCA.
GeneTreeiENSGT00550000074473.
HOVERGENiHBG018957.
InParanoidiB1AZP2.
OMAiPSWEEDY.
OrthoDBiEOG75QR37.
PhylomeDBiB1AZP2.
TreeFamiTF321382.

Miscellaneous databases

ChiTaRSiDlgap4. mouse.
PROiB1AZP2.
SOURCEiSearch...

Gene expression databases

BgeeiB1AZP2.
ExpressionAtlasiB1AZP2. baseline and differential.
GenevisibleiB1AZP2. MM.

Family and domain databases

InterProiIPR030527. DLGAP4.
IPR005026. SAPAP.
[Graphical view]
PANTHERiPTHR12353:SF19. PTHR12353:SF19. 2 hits.
PfamiPF03359. GKAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Differential mRNA expression and protein localization of the SAP90/PSD-95-associated proteins (SAPAPs) in the nervous system of the mouse."
    Welch J.M., Wang D., Feng G.
    J. Comp. Neurol. 472:24-39(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: ICR.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J, FVB/N and FVB/N-3.
    Tissue: Brain and Mammary tumor.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  6. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-377, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  7. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
    Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
    Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain cortex.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-207; SER-384; SER-388; SER-405; SER-415; SER-421; SER-580; SER-581; SER-609; SER-611; SER-665; SER-744; THR-915 AND SER-973, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Heart, Kidney, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiDLGP4_MOUSE
AccessioniPrimary (citable) accession number: B1AZP2
Secondary accession number(s): B1AZP3
, B7ZNS1, Q3KQQ8, Q6PD44, Q6XBF1, Q80TN3, Q8R3U9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: April 8, 2008
Last modified: June 8, 2016
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.