Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large-associated protein 4

Gene

Dlgap4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-6794361 Neurexins and neuroligins

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large-associated protein 4
Short name:
DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name:
SAPAP-4
Gene namesi
Name:Dlgap4
Synonyms:Kiaa0964, Sapap4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2138865 Dlgap4

Subcellular locationi

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003450181 – 992Disks large-associated protein 4Add BLAST992

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei206PhosphoserineBy similarity1
Modified residuei207PhosphoserineCombined sources1
Modified residuei290Omega-N-methylarginineCombined sources1
Modified residuei377PhosphoserineCombined sources1
Modified residuei380PhosphoserineBy similarity1
Modified residuei384PhosphoserineCombined sources1
Modified residuei388PhosphoserineCombined sources1
Modified residuei405PhosphoserineCombined sources1
Modified residuei415PhosphoserineCombined sources1
Modified residuei421PhosphoserineCombined sources1
Modified residuei580PhosphoserineCombined sources1
Modified residuei581PhosphoserineCombined sources1
Modified residuei609PhosphoserineCombined sources1
Modified residuei611PhosphoserineCombined sources1
Modified residuei665PhosphoserineCombined sources1
Modified residuei744PhosphoserineCombined sources1
Modified residuei915PhosphothreonineCombined sources1
Modified residuei973PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiB1AZP2
PaxDbiB1AZP2
PRIDEiB1AZP2

PTM databases

iPTMnetiB1AZP2
PhosphoSitePlusiB1AZP2

Expressioni

Gene expression databases

BgeeiENSMUSG00000061689
ExpressionAtlasiB1AZP2 baseline and differential
GenevisibleiB1AZP2 MM

Interactioni

Subunit structurei

Interacts with DLG1 and DLG4/PSD-95.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi230780, 12 interactors
IntActiB1AZP2, 13 interactors
MINTiB1AZP2
STRINGi10090.ENSMUSP00000126980

Structurei

3D structure databases

ProteinModelPortaliB1AZP2
SMRiB1AZP2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

eggNOGiKOG3971 Eukaryota
ENOG4111JKV LUCA
GeneTreeiENSGT00550000074473
HOVERGENiHBG018957
InParanoidiB1AZP2
OMAiPSWEEDY
OrthoDBiEOG091G0J9O
PhylomeDBiB1AZP2
TreeFamiTF321382

Family and domain databases

InterProiView protein in InterPro
IPR030527 DLGAP4
IPR005026 SAPAP
PANTHERiPTHR12353:SF19 PTHR12353:SF19, 1 hit
PfamiView protein in Pfam
PF03359 GKAP, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: B1AZP2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKGLGDSRPR HLSDSLDPPH EPLFAGPDRN PYLLSPTEAF AREARFPGQN
60 70 80 90 100
TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL
110 120 130 140 150
PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF
160 170 180 190 200
FTKAPSMEGT AGKVGGNGSK KGGLEDGKGR RAKSKERAKA GEPKRRSRSN
210 220 230 240 250
ISGWWSSDDN LDGEGGAFRS GPASGLMTLG RQQERTQPRY FMHAYNTISG
260 270 280 290 300
HMLKTTKNTT TELTAPPPPP APPATCPSLG VGTDTNYVKR GSWSTLTLSH
310 320 330 340 350
AHEVCQKTSA TLDKSLLKSK SCHQGLAYHY LQVPGGGGEW STTLLSPRDM
360 370 380 390 400
DSTAEGPIPC RRMRSGSYIK AMGDEDSDES GGGSPKPSPK TAARRQSYLR
410 420 430 440 450
ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEDDYNPI SDSLNDSSCI
460 470 480 490 500
SQVFGQASLI PQLFGHDQQV READLSDQYE AACESACSEA ESTTAEALDL
510 520 530 540 550
PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS
560 570 580 590 600
SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT
610 620 630 640 650
SQSGLSNSSD SLDSSTRPPS VTRGGITPGP EAPEPPPKHA ALKSEQGTLT
660 670 680 690 700
SSESHSEAIP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGIQVEDDWR
710 720 730 740 750
SSAPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTSHP NSISIDAGPR
760 770 780 790 800
QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC
810 820 830 840 850
RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ
860 870 880 890 900
LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD
910 920 930 940 950
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKAAV SRDKASDAGD
960 970 980 990
KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL
Length:992
Mass (Da):108,037
Last modified:April 8, 2008 - v1
Checksum:iA33016920922ABB9
GO
Isoform 2 (identifier: B1AZP2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGIQVEDDWR → ERTRRSGSHLSEDNGPKAIDVMAPSSE

Show »
Length:989
Mass (Da):107,551
Checksum:iFC0D22EB3BD0C09F
GO
Isoform 3 (identifier: B1AZP2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Show »
Length:453
Mass (Da):49,460
Checksum:iF631D60B5FB7D916
GO

Sequence cautioni

The sequence BAC65690 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti614S → N in AAH24558 (PubMed:15489334).Curated1
Sequence conflicti676Missing in AAO89220 (PubMed:15024750).Curated1
Sequence conflicti689Q → E in AAO89220 (PubMed:15024750).Curated1
Sequence conflicti693I → V in AAO89220 (PubMed:15024750).Curated1
Sequence conflicti693I → V in AAH24558 (PubMed:15489334).Curated1
Sequence conflicti693I → V in AAI06095 (PubMed:15489334).Curated1
Sequence conflicti774A → V in AAH24558 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0349071 – 539Missing in isoform 3. 1 PublicationAdd BLAST539
Alternative sequenceiVSP_034908540 – 550GSLSNSRTLPS → MALCLELLKQC in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_034909671 – 700VDCIQ…EDDWR → ERTRRSGSHLSEDNGPKAID VMAPSSE in isoform 2. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122408 Transcribed RNA Translation: BAC65690.2 Sequence problems.
AY243849 mRNA Translation: AAO89220.2
BX004793, BX571766 Genomic DNA Translation: CAM16917.1
BX571766, BX004793 Genomic DNA Translation: CAM22345.1
BX004793, BX571766 Genomic DNA Translation: CAM16918.1
BX571766, BX004793 Genomic DNA Translation: CAM22346.1
BX004793, BX571766 Genomic DNA Translation: CAM16919.1
BX571766, BX004793 Genomic DNA Translation: CAM22347.1
BC024558 mRNA Translation: AAH24558.1
BC058948 mRNA Translation: AAH58948.1
BC085475 mRNA Translation: AAH85475.1
BC106094 mRNA Translation: AAI06095.1
BC141110 mRNA Translation: AAI41111.1
BC145394 mRNA Translation: AAI45395.1
CCDSiCCDS16968.1 [B1AZP2-1]
CCDS38299.1 [B1AZP2-3]
CCDS71171.1 [B1AZP2-2]
RefSeqiNP_001035952.1, NM_001042487.1 [B1AZP2-3]
NP_001035953.1, NM_001042488.2
NP_001264115.1, NM_001277186.1 [B1AZP2-2]
NP_001264116.1, NM_001277187.1
NP_666240.4, NM_146128.6 [B1AZP2-1]
XP_006499403.1, XM_006499340.3 [B1AZP2-1]
UniGeneiMm.22094
Mm.491757

Genome annotation databases

EnsembliENSMUST00000070782; ENSMUSP00000068745; ENSMUSG00000061689 [B1AZP2-2]
ENSMUST00000099145; ENSMUSP00000096749; ENSMUSG00000061689 [B1AZP2-3]
ENSMUST00000109567; ENSMUSP00000105195; ENSMUSG00000061689 [B1AZP2-2]
ENSMUST00000169464; ENSMUSP00000126980; ENSMUSG00000061689 [B1AZP2-1]
GeneIDi228836
KEGGimmu:228836
UCSCiuc008nnr.2 mouse [B1AZP2-1]
uc008nnv.1 mouse [B1AZP2-3]
uc012chv.2 mouse [B1AZP2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDLGP4_MOUSE
AccessioniPrimary (citable) accession number: B1AZP2
Secondary accession number(s): B1AZP3
, B7ZNS1, Q3KQQ8, Q6PD44, Q6XBF1, Q80TN3, Q8R3U9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: April 8, 2008
Last modified: April 25, 2018
This is version 89 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health