Reviewed,
UniProtKB/Swiss-Prot B1AS42 (NB5R5_MOUSE)
Last modified
July 7, 2009.
Version 14.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: NADH-cytochrome b5 reductase-like EC=1.6.2.2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 316 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction By similarity. |
| Catalytic activity | NADH + 2 ferricytochrome b5 = NAD+ + H+ + 2 ferrocytochrome b5. |
| Cofactor | FAD By similarity. |
| Sequence similarities | Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family. Contains 1 FAD-binding FR-type domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | FAD Flavoprotein NAD |
| Molecular function | Oxidoreductase |
| Gene Ontology (GO) | |
| Biological process | oxidation reduction Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | cytochrome-b5 reductase activity Inferred from electronic annotation. Source: EC electron carrier activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: B1AS42-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: B1AS42-2) The sequence of this isoform differs from the canonical sequence as follows: 146-180: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: B1AS42-3) The sequence of this isoform differs from the canonical sequence as follows: 1-60: Missing. 61-67: KQPPESQ → MNNKDLE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: B1AS42-4) The sequence of this isoform differs from the canonical sequence as follows: 1-85: Missing. 250-283: EVSPEQLPWSYRDKTHFGRLGQELVAELVACCRR → ASPSPSYRGGSRLTEVLDQGGARTGPVCLTLLSL 284-316: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 316 | 316 | NADH-cytochrome b5 reductase-like | PRO_0000337042 | |||||
Regions | |||||||||
| Domain | 76 – 178 | 103 | FAD-binding FR-type | ||||||
| Nucleotide binding | 158 – 173 | 16 | FAD By similarity | ||||||
| Nucleotide binding | 183 – 215 | 33 | FAD By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 85 | 85 | Missing in isoform 4. | VSP_033848 | |||||
| Alternative sequence | 1 – 60 | 60 | Missing in isoform 3. | VSP_033849 | |||||
| Alternative sequence | 61 – 67 | 7 | KQPPESQ → MNNKDLE in isoform 3. | VSP_033850 | |||||
| Alternative sequence | 146 – 180 | 35 | Missing in isoform 2. | VSP_033851 | |||||
| Alternative sequence | 250 – 283 | 34 | EVSPE…ACCRR → ASPSPSYRGGSRLTEVLDQG GARTGPVCLTLLSL in isoform 4. | VSP_033852 | |||||
| Alternative sequence | 284 – 316 | 33 | Missing in isoform 4. | VSP_033853 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of mouse homologues of FLJ genes: the complete nucleotide sequences of 110 mouse FLJ-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H. DNA Res. 11:127-135(2004) [PubMed: 15449545] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Strain: ICR. Tissue: Embryonic tail. |
| [2] | The mouse genome sequencing consortium Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: FVB/N. Tissue: Liver and Mammary tumor. |
Cross-references
Sequence databases | |
|---|---|
| AK220154 mRNA. Translation: BAD90340.1. Different initiation. AL607132 Genomic DNA. Translation: CAM46300.2. AL607132 Genomic DNA. Translation: CAM46301.1. BC004750 mRNA. Translation: AAH04750.1. Different initiation. BC043687 mRNA. Translation: AAH43687.1. | |
| IPI | IPI00320088. IPI00403588. IPI00895275. IPI00895324. |
| RefSeq | NP_780680.1. |
| UniGene | Mm.44608 |
3D structure databases | |
| ModBase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUSG00000028621. Mus musculus. [Contig view] |
| GeneID | 230582. |
| KEGG | mmu:230582. |
Organism-specific databases | |
| MGI | MGI:1919657. Cyb5rl. |
Phylogenomic databases | |
| OMA | B1AS42. ECERILQ. |
Gene expression databases | |
| Bgee | B1AS42. |
Family and domain databases | |
| InterPro | IPR017927. Fd_Rdtase_FAD-bd. IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase. IPR001834. NADH-Cyt_B5_reductase. IPR008333. OxRdtase_FAD-bd. IPR001433. OxRdtase_FAD/NAD_bd. [Graphical view] |
| Pfam | PF00970. FAD_binding_6. 1 hit. PF00175. NAD_binding_1. 1 hit. [Graphical view] |
| PRINTS | PR00406. CYTB5RDTASE. PR00371. FPNCR. |
| PROSITE | PS51384. FAD_FR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 379943. |
| SOURCE | Search... |
Entry information
| Entry name | NB5R5_MOUSE | ||||||||
| Accession | Primary (citable) accession number: B1AS42 Secondary accession number(s): B1AS41 Q99KB7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


