Reviewed,
UniProtKB/Swiss-Prot P27216 (ANX13_HUMAN)
Last modified
November 25, 2008.
Version 83.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Annexin A13 Alternative name(s): Annexin-13 Annexin XIII Annexin, intestine-specific ISA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 316 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subcellular location | Cell membrane. Note= Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes. |
| Tissue specificity | Gut specific. |
| Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
| Sequence similarities | Belongs to the annexin family. Contains 4 annexin repeats. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Annexin Repeat |
| Ligand | Calcium Calcium/phospholipid-binding |
| PTM | Lipoprotein Myristate |
Gene Ontology (GO) | |
| Biological process | cell differentiation Ref.1 Non-traceable author statement. Source: UniProtKB |
| Cellular component | plasma membrane Ref.1 Non-traceable author statement. Source: UniProtKB |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro calcium-dependent phospholipid bindingNon-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P27216-1) Also known as: Anx13A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P27216-2) Also known as: Anx13B; The sequence of this isoform differs from the canonical sequence as follows: 5-5: H → HSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 316 | 315 | Annexin A13 | PRO_0000067514 | |||||
Regions | |||||||||
| Repeat | 23 – 83 | 61 | Annexin 1 | ||||||
| Repeat | 95 – 155 | 61 | Annexin 2 | ||||||
| Repeat | 179 – 239 | 61 | Annexin 3 | ||||||
| Repeat | 254 – 314 | 61 | Annexin 4 | ||||||
Amino acid modifications | |||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine | ||||||
Natural variations | |||||||||
| Alternative sequence | 5 | 1 | H → HSQSYTLSEGSQQLPKGDSQ PSTVVQPLSHPSRNGEPEAP QP in isoform B. | VSP_000291 | |||||
Experimental info | |||||||||
| Sequence conflict | 112 | 1 | F → V in CAC34622. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin." Wice B.M., Gordon J.I. J. Cell Biol. 116:405-422(1992) [PubMed: 1530946] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), MYRISTOYLATION AT GLY-2. |
| [2] | "Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins." Iglesias J.M., Morgan R.O., Jenkins N.A., Copeland N.G., Gilbert D.J., Fernandez M.-P. Mol. Biol. Evol. 19:608-618(2002) [PubMed: 11961095] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Tissue: Colon adenocarcinoma. |
Cross-references
Sequence databases | |
|---|---|
| Z11502 mRNA. Translation: CAA77578.1. AJ306450 mRNA. Translation: CAC34622.1. | |
| PIR | LUHUIS. A41733. |
| RefSeq | NP_001003954.1. NP_004297.2. |
| UniGene | Hs.181107 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1ANN based on UniProtKB P13214. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P27216. |
Genome annotation databases | |
| Ensembl | ENSG00000104537. Homo sapiens. [Contig view] |
| GeneID | 312. |
| KEGG | hsa:312. |
Organism-specific databases | |
| HGNC | HGNC:536. ANXA13. |
| MIM | 602573. gene. |
| PharmGKB | PA24826. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | P27216. |
| HOVERGEN | P27216. |
Gene expression databases | |
| ArrayExpress | P27216. |
| CleanEx | HS_ANXA13. |
| GermOnline | ENSG00000104537. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001464. Annexin. IPR009166. AnnexinXIII. [Graphical view] |
| Gene3D | G3DSA:1.10.220.10. Annexin. 4 hits. |
| PANTHER | PTHR10502. Annexin. 1 hit. |
| Pfam | PF00191. Annexin. 4 hits. [Graphical view] |
| PRINTS | PR00196. ANNEXIN. PR01811. ANNEXINXIII. |
| ProDom | PD000143. Annexin. 4 hits. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00335. ANX. 4 hits. [Graphical view] |
| PROSITE | PS00223. ANNEXIN. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 1267. |
| SOURCE | Search... |
Entry information
| Entry name | ANX13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P27216 Secondary accession number(s): Q9BQR5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


