Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MIF4G domain-containing protein

Gene

MIF4GD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation.1 Publication

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB
  • RNA binding Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Translation regulation

Names & Taxonomyi

Protein namesi
Recommended name:
MIF4G domain-containing protein
Alternative name(s):
SLBP-interacting protein 1
Short name:
hSLIP1
Gene namesi
Name:MIF4GD
Synonyms:SLIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:24030. MIF4GD.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671457.

Polymorphism and mutation databases

BioMutaiMIF4GD.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 222222MIF4G domain-containing proteinPRO_0000337089Add
BLAST

Proteomic databases

EPDiA9UHW6.
MaxQBiA9UHW6.
PRIDEiA9UHW6.

PTM databases

iPTMnetiA9UHW6.
PhosphoSiteiA9UHW6.

Expressioni

Gene expression databases

BgeeiENSG00000125457.
CleanExiHS_MIF4GD.
ExpressionAtlasiA9UHW6. baseline and differential.
GenevisibleiA9UHW6. HS.

Organism-specific databases

HPAiHPA051222.

Interactioni

Subunit structurei

Interacts with EIF4G1, EIF4G2 and SLBP; probably tethered by SLBP to the 3'-end of mRNAs ending with the histone stem-loop, it also interacts with EIF4G1 which is bound to their 5'-end.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
DDX19AQ9NUU75EBI-373498,EBI-740301
DDX19BQ9UMR23EBI-373498,EBI-719232
HDAC4P565244EBI-373498,EBI-308629
HGSO149644EBI-373498,EBI-740220
PDE4DIPQ5VU433EBI-373498,EBI-1105124

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121511. 20 interactions.
IntActiA9UHW6. 11 interactions.
MINTiMINT-1450950.

Structurei

3D structure databases

ProteinModelPortaliA9UHW6.
SMRiA9UHW6. Positions 7-218.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini3 – 205203MIF4GAdd
BLAST

Sequence similaritiesi

Belongs to the MIF4GD family.Curated
Contains 1 MIF4G domain.Curated

Phylogenomic databases

GeneTreeiENSGT00630000089865.
HOGENOMiHOG000231168.
HOVERGENiHBG055294.
InParanoidiA9UHW6.
OrthoDBiEOG091G05G0.
PhylomeDBiA9UHW6.

Family and domain databases

Gene3Di1.25.40.180. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR016021. MIF4-like.
IPR003890. MIF4G-like_typ-3.
[Graphical view]
PfamiPF02854. MIF4G. 1 hit.
[Graphical view]
SMARTiSM00543. MIF4G. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A9UHW6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEPSREEYK IQSFDAETQQ LLKTALKDPG AVDLEKVANV IVDHSLQDCV
60 70 80 90 100
FSKEAGRMCY AIIQAESKQA GQSVFRRGLL NRLQQEYQAR EQLRARSLQG
110 120 130 140 150
WVCYVTFICN IFDYLRVNNM PMMALVNPVY DCLFRLAQPD SLSKEEEVDC
160 170 180 190 200
LVLQLHRVGE QLEKMNGQRM DELFVLIRDG FLLPTGLSSL AQLLLLEIIE
210 220
FRAAGWKTTP AAHKYYYSEV SD
Length:222
Mass (Da):25,423
Last modified:February 5, 2008 - v1
Checksum:i07E5B651D638AC9D
GO
Isoform 2 (identifier: A9UHW6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-27: K → KVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYR

Show »
Length:256
Mass (Da):29,390
Checksum:iEA6015A7B943B939
GO
Isoform 3 (identifier: A9UHW6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-27: K → KAPSLECTVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYR

Show »
Length:263
Mass (Da):30,091
Checksum:i1FA6F7F214E4BACA
GO

Sequence cautioni

The sequence AAG09724 differs from that shown. Reason: Frameshift at several positions. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei27 – 271K → KVACFETEDGEYSVCQRSYS NCSRLMPSRCNTQYR in isoform 2. 1 PublicationVSP_033877
Alternative sequencei27 – 271K → KAPSLECTVACFETEDGEYS VCQRSYSNCSRLMPSRCNTQ YR in isoform 3. 2 PublicationsVSP_047408

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU287989 mRNA. Translation: ABX83907.1.
AL555095 mRNA. No translation available.
AK300711 mRNA. Translation: BAG62389.1.
AC022211 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89263.1.
BC033759 mRNA. Translation: AAH33759.1.
AF225422 mRNA. Translation: AAG09724.1. Frameshift.
CCDSiCCDS11719.1. [A9UHW6-2]
CCDS56044.1. [A9UHW6-1]
CCDS58598.1. [A9UHW6-3]
RefSeqiNP_001229427.1. NM_001242498.1. [A9UHW6-3]
NP_001229429.1. NM_001242500.1. [A9UHW6-2]
NP_001229430.1. NM_001242501.1. [A9UHW6-1]
NP_065730.2. NM_020679.3. [A9UHW6-2]
XP_005257587.1. XM_005257530.1. [A9UHW6-3]
XP_005257589.1. XM_005257532.4. [A9UHW6-1]
XP_005257590.1. XM_005257533.1. [A9UHW6-1]
UniGeneiHs.325631.

Genome annotation databases

EnsembliENST00000245551; ENSP00000245551; ENSG00000125457. [A9UHW6-2]
ENST00000325102; ENSP00000321625; ENSG00000125457. [A9UHW6-1]
ENST00000577542; ENSP00000463334; ENSG00000125457. [A9UHW6-3]
ENST00000579297; ENSP00000462459; ENSG00000125457. [A9UHW6-3]
ENST00000618645; ENSP00000484245; ENSG00000125457. [A9UHW6-1]
GeneIDi57409.
KEGGihsa:57409.
UCSCiuc002jnp.5. human. [A9UHW6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU287989 mRNA. Translation: ABX83907.1.
AL555095 mRNA. No translation available.
AK300711 mRNA. Translation: BAG62389.1.
AC022211 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89263.1.
BC033759 mRNA. Translation: AAH33759.1.
AF225422 mRNA. Translation: AAG09724.1. Frameshift.
CCDSiCCDS11719.1. [A9UHW6-2]
CCDS56044.1. [A9UHW6-1]
CCDS58598.1. [A9UHW6-3]
RefSeqiNP_001229427.1. NM_001242498.1. [A9UHW6-3]
NP_001229429.1. NM_001242500.1. [A9UHW6-2]
NP_001229430.1. NM_001242501.1. [A9UHW6-1]
NP_065730.2. NM_020679.3. [A9UHW6-2]
XP_005257587.1. XM_005257530.1. [A9UHW6-3]
XP_005257589.1. XM_005257532.4. [A9UHW6-1]
XP_005257590.1. XM_005257533.1. [A9UHW6-1]
UniGeneiHs.325631.

3D structure databases

ProteinModelPortaliA9UHW6.
SMRiA9UHW6. Positions 7-218.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121511. 20 interactions.
IntActiA9UHW6. 11 interactions.
MINTiMINT-1450950.

PTM databases

iPTMnetiA9UHW6.
PhosphoSiteiA9UHW6.

Polymorphism and mutation databases

BioMutaiMIF4GD.

Proteomic databases

EPDiA9UHW6.
MaxQBiA9UHW6.
PRIDEiA9UHW6.

Protocols and materials databases

DNASUi57409.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245551; ENSP00000245551; ENSG00000125457. [A9UHW6-2]
ENST00000325102; ENSP00000321625; ENSG00000125457. [A9UHW6-1]
ENST00000577542; ENSP00000463334; ENSG00000125457. [A9UHW6-3]
ENST00000579297; ENSP00000462459; ENSG00000125457. [A9UHW6-3]
ENST00000618645; ENSP00000484245; ENSG00000125457. [A9UHW6-1]
GeneIDi57409.
KEGGihsa:57409.
UCSCiuc002jnp.5. human. [A9UHW6-1]

Organism-specific databases

CTDi57409.
GeneCardsiMIF4GD.
H-InvDBHIX0202398.
HGNCiHGNC:24030. MIF4GD.
HPAiHPA051222.
MIMi612072. gene.
neXtProtiNX_A9UHW6.
PharmGKBiPA142671457.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00630000089865.
HOGENOMiHOG000231168.
HOVERGENiHBG055294.
InParanoidiA9UHW6.
OrthoDBiEOG091G05G0.
PhylomeDBiA9UHW6.

Miscellaneous databases

GenomeRNAii57409.
PROiA9UHW6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125457.
CleanExiHS_MIF4GD.
ExpressionAtlasiA9UHW6. baseline and differential.
GenevisibleiA9UHW6. HS.

Family and domain databases

Gene3Di1.25.40.180. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR016021. MIF4-like.
IPR003890. MIF4G-like_typ-3.
[Graphical view]
PfamiPF02854. MIF4G. 1 hit.
[Graphical view]
SMARTiSM00543. MIF4G. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMI4GD_HUMAN
AccessioniPrimary (citable) accession number: A9UHW6
Secondary accession number(s): B4DUM7, Q8N4Q5, Q9HBL5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 5, 2008
Last modified: September 7, 2016
This is version 83 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Depletion of MIF4GD results in cell death and reduced histone mRNA translation.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.