Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A8MYP8

- ODF3B_HUMAN

UniProt

A8MYP8 - ODF3B_HUMAN

Protein

Outer dense fiber protein 3B

Gene

ODF3B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 43 (01 Oct 2014)
      Sequence version 1 (04 Dec 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Outer dense fiber protein 3B
    Alternative name(s):
    Outer dense fiber protein 3-like protein 3
    Gene namesi
    Name:ODF3B
    Synonyms:ODF3L3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:34388. ODF3B.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162398386.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 253253Outer dense fiber protein 3BPRO_0000346440Add
    BLAST

    Proteomic databases

    PaxDbiA8MYP8.
    PRIDEiA8MYP8.

    Expressioni

    Gene expression databases

    ArrayExpressiA8MYP8.
    BgeeiA8MYP8.
    CleanExiHS_ODF3B.
    GenevestigatoriA8MYP8.

    Organism-specific databases

    HPAiHPA062837.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000382804.

    Structurei

    3D structure databases

    ProteinModelPortaliA8MYP8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati182 – 20726STPGRAdd
    BLAST

    Sequence similaritiesi

    Belongs to the ODF3 family.Curated

    Phylogenomic databases

    eggNOGiNOG72574.
    HOGENOMiHOG000090412.
    HOVERGENiHBG054464.
    PhylomeDBiA8MYP8.
    TreeFamiTF325804.

    Family and domain databases

    InterProiIPR010736. SHIPPO-rpt.
    [Graphical view]
    PfamiPF07004. SHIPPO-rpt. 6 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A8MYP8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSDAWVGLW RPHRPRGPIA AHYGGPGPKY KLPPNTGYAL HDPSRPRAPA    50
    FTFGARFPTQ QTTCGPGPGH LVPARMTVRG TDGAPAYSIY GRPRRSAPFL 100
    TPGPGRYFPE RAGNATYPSA PRHTIAPRNW GVQAEQQSPG PAAYTVPSLL 150
    GPRVIGKVSA PTCSIYGRRA AGSFFEDLSK TPGPCAYQVV SPGVYKSRAP 200
    QFTILARTSL PQDNTRKPGP AAYNVDQHRK PRGWSFGIRH SDYLAPLVTD 250
    ADN 253

    Note: Gene prediction based on EST data.

    Length:253
    Mass (Da):27,280
    Last modified:December 4, 2007 - v1
    Checksum:iAB7BCC87C5347B5A
    GO
    Isoform 2 (identifier: A8MYP8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNT → MGLGAGPGQTLTRMLP
         106-129: RYFPERAGNATYPSAPRHTIAPRN → QDPRAPGHPNAELPPGRPTWEPPT
         130-253: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:109
    Mass (Da):11,447
    Checksum:i79692E9C77DDFDF4
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636MGSDA…LPPNT → MGLGAGPGQTLTRMLP in isoform 2. 1 PublicationVSP_034995Add
    BLAST
    Alternative sequencei106 – 12924RYFPE…IAPRN → QDPRAPGHPNAELPPGRPTW EPPT in isoform 2. 1 PublicationVSP_034996Add
    BLAST
    Alternative sequencei130 – 253124Missing in isoform 2. 1 PublicationVSP_034997Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U62317 Genomic DNA. No translation available.
    BC127934 mRNA. Translation: AAI27935.1.
    CCDSiCCDS43039.1. [A8MYP8-1]
    RefSeqiNP_001014440.2. NM_001014440.3. [A8MYP8-1]
    XP_005261975.1. XM_005261918.2. [A8MYP8-1]
    UniGeneiHs.531314.

    Genome annotation databases

    EnsembliENST00000329363; ENSP00000382804; ENSG00000177989. [A8MYP8-1]
    ENST00000428989; ENSP00000390712; ENSG00000177989. [A8MYP8-1]
    GeneIDi440836.
    KEGGihsa:440836.
    UCSCiuc003bmh.2. human. [A8MYP8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U62317 Genomic DNA. No translation available.
    BC127934 mRNA. Translation: AAI27935.1 .
    CCDSi CCDS43039.1. [A8MYP8-1 ]
    RefSeqi NP_001014440.2. NM_001014440.3. [A8MYP8-1 ]
    XP_005261975.1. XM_005261918.2. [A8MYP8-1 ]
    UniGenei Hs.531314.

    3D structure databases

    ProteinModelPortali A8MYP8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000382804.

    Proteomic databases

    PaxDbi A8MYP8.
    PRIDEi A8MYP8.

    Protocols and materials databases

    DNASUi 440836.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000329363 ; ENSP00000382804 ; ENSG00000177989 . [A8MYP8-1 ]
    ENST00000428989 ; ENSP00000390712 ; ENSG00000177989 . [A8MYP8-1 ]
    GeneIDi 440836.
    KEGGi hsa:440836.
    UCSCi uc003bmh.2. human. [A8MYP8-1 ]

    Organism-specific databases

    CTDi 440836.
    GeneCardsi GC22M050968.
    HGNCi HGNC:34388. ODF3B.
    HPAi HPA062837.
    neXtProti NX_A8MYP8.
    PharmGKBi PA162398386.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72574.
    HOGENOMi HOG000090412.
    HOVERGENi HBG054464.
    PhylomeDBi A8MYP8.
    TreeFami TF325804.

    Miscellaneous databases

    ChiTaRSi ODF3B. human.
    GenomeRNAii 440836.
    NextBioi 109537.
    PROi A8MYP8.

    Gene expression databases

    ArrayExpressi A8MYP8.
    Bgeei A8MYP8.
    CleanExi HS_ODF3B.
    Genevestigatori A8MYP8.

    Family and domain databases

    InterProi IPR010736. SHIPPO-rpt.
    [Graphical view ]
    Pfami PF07004. SHIPPO-rpt. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiODF3B_HUMAN
    AccessioniPrimary (citable) accession number: A8MYP8
    Secondary accession number(s): A0PK18
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 2, 2008
    Last sequence update: December 4, 2007
    Last modified: October 1, 2014
    This is version 43 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3