A8MYP8 (ODF3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 34.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Outer dense fiber protein 3B Alternative name(s): Outer dense fiber protein 3-like protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 253 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the ODF3 family. Contains 1 STPGR (Sperm-tail PG-rich) repeat. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A8MYP8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Gene prediction based on EST data. | ||||||
| Isoform 2 (identifier: A8MYP8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNT → MGLGAGPGQTLTRMLP 106-129: RYFPERAGNATYPSAPRHTIAPRN → QDPRAPGHPNAELPPGRPTWEPPT 130-253: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 253 | 253 | Outer dense fiber protein 3B | PRO_0000346440 | |||||
Regions | |||||||||
| Repeat | 182 – 207 | 26 | STPGR | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MGSDA…LPPNT → MGLGAGPGQTLTRMLP in isoform 2. | VSP_034995 | |||||
| Alternative sequence | 106 – 129 | 24 | RYFPE…IAPRN → QDPRAPGHPNAELPPGRPTW EPPT in isoform 2. | VSP_034996 | |||||
| Alternative sequence | 130 – 253 | 124 | Missing in isoform 2. | VSP_034997 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U62317 Genomic DNA. No translation available. BC127934 mRNA. Translation: AAI27935.1. |
| IPI | IPI00827954. IPI00877138. |
| RefSeq | NP_001014440.2. NM_001014440.3. |
| UniGene | Hs.531314. |
3D structure databases | |
| ProteinModelPortal | A8MYP8. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | A8MYP8. |
| PRIDE | A8MYP8. |
Protocols and materials databases | |
| DNASU | 440836. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000329363; ENSP00000382804; ENSG00000177989. ENST00000428989; ENSP00000390712; ENSG00000177989. |
| GeneID | 440836. |
| KEGG | hsa:440836. |
| UCSC | uc003bmh.2. human. |
Organism-specific databases | |
| CTD | 440836. |
| GeneCards | GC22M050968. |
| HGNC | HGNC:34388. ODF3B. |
| neXtProt | NX_A8MYP8. |
| PharmGKB | PA162398386. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72574. |
| HOGENOM | HOG000090412. |
| HOVERGEN | HBG054464. |
Gene expression databases | |
| ArrayExpress | A8MYP8. |
| Bgee | A8MYP8. |
| CleanEx | HS_ODF3B. |
| Genevestigator | A8MYP8. |
Family and domain databases | |
| InterPro | IPR010736. SHIPPO-rpt. [Graphical view] |
| Pfam | PF07004. SHIPPO-rpt. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ODF3B. human. |
| GenomeRNAi | 440836. |
| NextBio | 109537. |
Entry information
| Entry name | ODF3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A8MYP8 Secondary accession number(s): A0PK18 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
