Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A8MYP8 (ODF3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 39. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Outer dense fiber protein 3B
Alternative name(s):
Outer dense fiber protein 3-like protein 3
Gene names
Name:ODF3B
Synonyms:ODF3L3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length253 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Belongs to the ODF3 family.

Contains 1 STPGR (Sperm-tail PG-rich) repeat.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A8MYP8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Gene prediction based on EST data.
Isoform 2 (identifier: A8MYP8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNT → MGLGAGPGQTLTRMLP
     106-129: RYFPERAGNATYPSAPRHTIAPRN → QDPRAPGHPNAELPPGRPTWEPPT
     130-253: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 253253Outer dense fiber protein 3B
PRO_0000346440

Regions

Repeat182 – 20726STPGR

Natural variations

Alternative sequence1 – 3636MGSDA…LPPNT → MGLGAGPGQTLTRMLP in isoform 2.
VSP_034995
Alternative sequence106 – 12924RYFPE…IAPRN → QDPRAPGHPNAELPPGRPTW EPPT in isoform 2.
VSP_034996
Alternative sequence130 – 253124Missing in isoform 2.
VSP_034997

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 4, 2007. Version 1.
Checksum: AB7BCC87C5347B5A

FASTA25327,280
        10         20         30         40         50         60 
MGSDAWVGLW RPHRPRGPIA AHYGGPGPKY KLPPNTGYAL HDPSRPRAPA FTFGARFPTQ 

        70         80         90        100        110        120 
QTTCGPGPGH LVPARMTVRG TDGAPAYSIY GRPRRSAPFL TPGPGRYFPE RAGNATYPSA 

       130        140        150        160        170        180 
PRHTIAPRNW GVQAEQQSPG PAAYTVPSLL GPRVIGKVSA PTCSIYGRRA AGSFFEDLSK 

       190        200        210        220        230        240 
TPGPCAYQVV SPGVYKSRAP QFTILARTSL PQDNTRKPGP AAYNVDQHRK PRGWSFGIRH 

       250 
SDYLAPLVTD ADN 

« Hide

Isoform 2 [UniParc].

Checksum: 79692E9C77DDFDF4
Show »

FASTA10911,447

References

[1]"The DNA sequence of human chromosome 22."
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. expand/collapse author list , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U62317 Genomic DNA. No translation available.
BC127934 mRNA. Translation: AAI27935.1.
RefSeqNP_001014440.2. NM_001014440.3.
XP_005261975.1. XM_005261918.1.
UniGeneHs.531314.

3D structure databases

ProteinModelPortalA8MYP8.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000382804.

Proteomic databases

PaxDbA8MYP8.
PRIDEA8MYP8.

Protocols and materials databases

DNASU440836.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000329363; ENSP00000382804; ENSG00000177989. [A8MYP8-1]
ENST00000428989; ENSP00000390712; ENSG00000177989. [A8MYP8-1]
GeneID440836.
KEGGhsa:440836.
UCSCuc003bmh.2. human. [A8MYP8-1]

Organism-specific databases

CTD440836.
GeneCardsGC22M050968.
HGNCHGNC:34388. ODF3B.
HPAHPA062837.
neXtProtNX_A8MYP8.
PharmGKBPA162398386.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG72574.
HOGENOMHOG000090412.
HOVERGENHBG054464.
TreeFamTF325804.

Gene expression databases

ArrayExpressA8MYP8.
BgeeA8MYP8.
CleanExHS_ODF3B.
GenevestigatorA8MYP8.

Family and domain databases

InterProIPR010736. SHIPPO-rpt.
[Graphical view]
PfamPF07004. SHIPPO-rpt. 6 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSODF3B. human.
GenomeRNAi440836.
NextBio109537.
PROA8MYP8.

Entry information

Entry nameODF3B_HUMAN
AccessionPrimary (citable) accession number: A8MYP8
Secondary accession number(s): A0PK18
Entry history
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: December 4, 2007
Last modified: March 19, 2014
This is version 39 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 22

Human chromosome 22: entries, gene names and cross-references to MIM