SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A8MYP8

- ODF3B_HUMAN

UniProt

A8MYP8 - ODF3B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Outer dense fiber protein 3B
Gene
ODF3B, ODF3L3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Outer dense fiber protein 3B
Alternative name(s):
Outer dense fiber protein 3-like protein 3
Gene namesi
Name:ODF3B
Synonyms:ODF3L3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:34388. ODF3B.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162398386.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 253253Outer dense fiber protein 3B
PRO_0000346440Add
BLAST

Proteomic databases

PaxDbiA8MYP8.
PRIDEiA8MYP8.

Expressioni

Gene expression databases

ArrayExpressiA8MYP8.
BgeeiA8MYP8.
CleanExiHS_ODF3B.
GenevestigatoriA8MYP8.

Organism-specific databases

HPAiHPA062837.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000382804.

Structurei

3D structure databases

ProteinModelPortaliA8MYP8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati182 – 20726STPGR
Add
BLAST

Sequence similaritiesi

Belongs to the ODF3 family.

Phylogenomic databases

eggNOGiNOG72574.
HOGENOMiHOG000090412.
HOVERGENiHBG054464.
PhylomeDBiA8MYP8.
TreeFamiTF325804.

Family and domain databases

InterProiIPR010736. SHIPPO-rpt.
[Graphical view]
PfamiPF07004. SHIPPO-rpt. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A8MYP8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGSDAWVGLW RPHRPRGPIA AHYGGPGPKY KLPPNTGYAL HDPSRPRAPA    50
FTFGARFPTQ QTTCGPGPGH LVPARMTVRG TDGAPAYSIY GRPRRSAPFL 100
TPGPGRYFPE RAGNATYPSA PRHTIAPRNW GVQAEQQSPG PAAYTVPSLL 150
GPRVIGKVSA PTCSIYGRRA AGSFFEDLSK TPGPCAYQVV SPGVYKSRAP 200
QFTILARTSL PQDNTRKPGP AAYNVDQHRK PRGWSFGIRH SDYLAPLVTD 250
ADN 253

Note: Gene prediction based on EST data.

Length:253
Mass (Da):27,280
Last modified:December 4, 2007 - v1
Checksum:iAB7BCC87C5347B5A
GO
Isoform 2 (identifier: A8MYP8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNT → MGLGAGPGQTLTRMLP
     106-129: RYFPERAGNATYPSAPRHTIAPRN → QDPRAPGHPNAELPPGRPTWEPPT
     130-253: Missing.

Note: No experimental confirmation available.

Show »
Length:109
Mass (Da):11,447
Checksum:i79692E9C77DDFDF4
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MGSDA…LPPNT → MGLGAGPGQTLTRMLP in isoform 2.
VSP_034995Add
BLAST
Alternative sequencei106 – 12924RYFPE…IAPRN → QDPRAPGHPNAELPPGRPTW EPPT in isoform 2.
VSP_034996Add
BLAST
Alternative sequencei130 – 253124Missing in isoform 2.
VSP_034997Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U62317 Genomic DNA. No translation available.
BC127934 mRNA. Translation: AAI27935.1.
CCDSiCCDS43039.1. [A8MYP8-1]
RefSeqiNP_001014440.2. NM_001014440.3. [A8MYP8-1]
XP_005261975.1. XM_005261918.2. [A8MYP8-1]
UniGeneiHs.531314.

Genome annotation databases

EnsembliENST00000329363; ENSP00000382804; ENSG00000177989. [A8MYP8-1]
ENST00000428989; ENSP00000390712; ENSG00000177989. [A8MYP8-1]
GeneIDi440836.
KEGGihsa:440836.
UCSCiuc003bmh.2. human. [A8MYP8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U62317 Genomic DNA. No translation available.
BC127934 mRNA. Translation: AAI27935.1 .
CCDSi CCDS43039.1. [A8MYP8-1 ]
RefSeqi NP_001014440.2. NM_001014440.3. [A8MYP8-1 ]
XP_005261975.1. XM_005261918.2. [A8MYP8-1 ]
UniGenei Hs.531314.

3D structure databases

ProteinModelPortali A8MYP8.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000382804.

Proteomic databases

PaxDbi A8MYP8.
PRIDEi A8MYP8.

Protocols and materials databases

DNASUi 440836.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000329363 ; ENSP00000382804 ; ENSG00000177989 . [A8MYP8-1 ]
ENST00000428989 ; ENSP00000390712 ; ENSG00000177989 . [A8MYP8-1 ]
GeneIDi 440836.
KEGGi hsa:440836.
UCSCi uc003bmh.2. human. [A8MYP8-1 ]

Organism-specific databases

CTDi 440836.
GeneCardsi GC22M050968.
HGNCi HGNC:34388. ODF3B.
HPAi HPA062837.
neXtProti NX_A8MYP8.
PharmGKBi PA162398386.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72574.
HOGENOMi HOG000090412.
HOVERGENi HBG054464.
PhylomeDBi A8MYP8.
TreeFami TF325804.

Miscellaneous databases

ChiTaRSi ODF3B. human.
GenomeRNAii 440836.
NextBioi 109537.
PROi A8MYP8.

Gene expression databases

ArrayExpressi A8MYP8.
Bgeei A8MYP8.
CleanExi HS_ODF3B.
Genevestigatori A8MYP8.

Family and domain databases

InterProi IPR010736. SHIPPO-rpt.
[Graphical view ]
Pfami PF07004. SHIPPO-rpt. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiODF3B_HUMAN
AccessioniPrimary (citable) accession number: A8MYP8
Secondary accession number(s): A0PK18
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: December 4, 2007
Last modified: July 9, 2014
This is version 42 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi