Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A8MVX0

- ARG33_HUMAN

UniProt

A8MVX0 - ARG33_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Rho guanine nucleotide exchange factor 33

Gene

ARHGEF33

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Functioni

May act as a guanine-nucleotide releasing factor.By similarity

GO - Molecular functioni

  1. Rho guanyl-nucleotide exchange factor activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 33
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:37252. ARHGEF33.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 844844Rho guanine nucleotide exchange factor 33PRO_0000342343Add
BLAST

Proteomic databases

PaxDbiA8MVX0.
PRIDEiA8MVX0.

PTM databases

PhosphoSiteiA8MVX0.

Expressioni

Gene expression databases

BgeeiA8MVX0.
ExpressionAtlasiA8MVX0. baseline.
GenevestigatoriA8MVX0.

Organism-specific databases

HPAiHPA034661.

Structurei

3D structure databases

ProteinModelPortaliA8MVX0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini265 – 440176DHPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili54 – 12976Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi522 – 5254Poly-Gln
Compositional biasi750 – 7567Poly-Ala

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG47910.
GeneTreeiENSGT00390000006230.
HOGENOMiHOG000168823.
HOVERGENiHBG098090.
InParanoidiA8MVX0.
OMAiQFCAAEQ.
OrthoDBiEOG7XH6P4.
PhylomeDBiA8MVX0.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
InterProiIPR000219. DH-domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A8MVX0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKTKTKQGE NEHMPVNNPS TQIYQLQALA SELKTGFTEA MQELSRIQHG
60 70 80 90 100
EYALEEKVKS CRCSMEEKVT EMKNSLNYFK EELSNAMSMI QAITSKQEEM
110 120 130 140 150
QQKIEQLQQE KRRESRKVKA KKTQKEEHSS QAGPAQAQGS PFRSINIPEP
160 170 180 190 200
VLPSEDFTNL LPSQAYEKAQ ESRSVHVGDS NVKGMMGPGV NPTTPEAEEN
210 220 230 240 250
LKSCLSADIQ SKGHLPSGMW RQPKDGKEWG EEYVTKDHPD KLKEAGQGRH
260 270 280 290 300
SSLENVLCET SLAAKRQTVA LELLESERKY VINISLILKI KATFQGSDGK
310 320 330 340 350
RNSKERSLFP GSLRYLVQQH LDLLHALQER VLKWPRQGVL GDLFLKLTND
360 370 380 390 400
ENNFLDYYVA YLRDLPECIS LVHVVVLKEG DEEIKSDIYT LFFHIVQRIP
410 420 430 440 450
EYLIHLQNVL KFTEQEHPDY YLLLVCVQRL RVFISHYTLL FQCNEDLLIQ
460 470 480 490 500
KRKKLKKSSM AKLYKGLASQ CANAGQDASP TAGPEAVRDT GIHSEELLQP
510 520 530 540 550
YPSAPSSGPA ITHLMPPVKK SQQQQSLMES MQPGKPSDWE LEGRKHERPE
560 570 580 590 600
SLLAPTQFCA AEQDVKALAG PLQAIPEMDF ESSPAEPLGN VERSLRAPAE
610 620 630 640 650
LLPDARGFVP AAYEEFEYGG EIFALPAPYD EEPFQAPALF ENCSPASSES
660 670 680 690 700
SLDICFLRPV SFAMEAERPE HPLQPLPKSA TSPAGSSSAY KLEAAAQAHG
710 720 730 740 750
KAKPLSRSLK EFPRAPPADG VAPRLYSTRS SSGGRAPIKA ERAAQAHGPA
760 770 780 790 800
AAAVAARGAS RTFFPQQRSQ SEKQTYLEVR REMHLEDTTR FCPKEERESE
810 820 830 840
QTSFSDQNPR QDQKGGFRSS FRKLFKKKNG NATGEDFCGP WGWW
Length:844
Mass (Da):94,633
Last modified:July 13, 2010 - v2
Checksum:i790FB919145D5C3E
GO
Isoform 2 (identifier: A8MVX0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     829-844: NGNATGEDFCGPWGWW → SSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV

Note: No experimental confirmation available.

Show »
Length:870
Mass (Da):97,524
Checksum:i9EA51122954F91BB
GO

Sequence cautioni

The sequence DV080278 differs from that shown. Reason: Frameshift at position 79. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei829 – 84416NGNAT…PWGWW → SSGSEYREKTNENPSMDPSP TKQDFFRNRLALANDLDQGT AV in isoform 2. 1 PublicationVSP_044905Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC018693 Genomic DNA. No translation available.
AC019171 Genomic DNA. No translation available.
DV080278 mRNA. No translation available.
AK123375 mRNA. No translation available.
CCDSiCCDS46263.2. [A8MVX0-2]
RefSeqiNP_001138923.2. NM_001145451.2. [A8MVX0-2]
UniGeneiHs.99841.

Genome annotation databases

EnsembliENST00000398800; ENSP00000381780; ENSG00000214694. [A8MVX0-2]
ENST00000409978; ENSP00000387020; ENSG00000214694. [A8MVX0-2]
GeneIDi100271715.
KEGGihsa:100271715.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC018693 Genomic DNA. No translation available.
AC019171 Genomic DNA. No translation available.
DV080278 mRNA. No translation available.
AK123375 mRNA. No translation available.
CCDSi CCDS46263.2. [A8MVX0-2 ]
RefSeqi NP_001138923.2. NM_001145451.2. [A8MVX0-2 ]
UniGenei Hs.99841.

3D structure databases

ProteinModelPortali A8MVX0.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei A8MVX0.

Proteomic databases

PaxDbi A8MVX0.
PRIDEi A8MVX0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000398800 ; ENSP00000381780 ; ENSG00000214694 . [A8MVX0-2 ]
ENST00000409978 ; ENSP00000387020 ; ENSG00000214694 . [A8MVX0-2 ]
GeneIDi 100271715.
KEGGi hsa:100271715.

Organism-specific databases

CTDi 100271715.
GeneCardsi GC02P039118.
HGNCi HGNC:37252. ARHGEF33.
HPAi HPA034661.
neXtProti NX_A8MVX0.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG47910.
GeneTreei ENSGT00390000006230.
HOGENOMi HOG000168823.
HOVERGENi HBG098090.
InParanoidi A8MVX0.
OMAi QFCAAEQ.
OrthoDBi EOG7XH6P4.
PhylomeDBi A8MVX0.

Miscellaneous databases

GenomeRNAii 100271715.
NextBioi 35535224.
PROi A8MVX0.

Gene expression databases

Bgeei A8MVX0.
ExpressionAtlasi A8MVX0. baseline.
Genevestigatori A8MVX0.

Family and domain databases

Gene3Di 1.20.900.10. 1 hit.
InterProi IPR000219. DH-domain.
[Graphical view ]
Pfami PF00621. RhoGEF. 1 hit.
[Graphical view ]
SUPFAMi SSF48065. SSF48065. 1 hit.
PROSITEi PS50010. DH_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Exhaustive RT-PCR and sequencing of all novel TWINSCAN predictions in human."
    Stevens M., Wei C., Gross S.S., McPherson J., Brent M.R.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-83 (ISOFORM 1/2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 747-844 (ISOFORM 2).
    Tissue: Caudate nucleus.

Entry informationi

Entry nameiARG33_HUMAN
AccessioniPrimary (citable) accession number: A8MVX0
Secondary accession number(s): J3KPX2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 13, 2010
Last modified: October 29, 2014
This is version 51 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3