A8MVX0 (ARG33_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 40.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rho guanine nucleotide exchange factor 33 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 844 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May act as a guanine-nucleotide releasing factor By similarity. |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. |
| Sequence caution | The sequence DV080278 differs from that shown. Reason: Frameshift at position 79. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Molecular function | Guanine-nucleotide releasing factor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of Rho protein signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular_component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular_function | Rho guanyl-nucleotide exchange factor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A8MVX0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A8MVX0-2) The sequence of this isoform differs from the canonical sequence as follows: 829-844: NGNATGEDFCGPWGWW → SSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 844 | 844 | Rho guanine nucleotide exchange factor 33 | PRO_0000342343 | |||||
Regions | |||||||||
| Domain | 265 – 440 | 176 | DH | ||||||
| Coiled coil | 54 – 129 | 76 | Potential | ||||||
| Compositional bias | 522 – 525 | 4 | Poly-Gln | ||||||
| Compositional bias | 750 – 756 | 7 | Poly-Ala | ||||||
Natural variations | |||||||||
| Alternative sequence | 829 – 844 | 16 | NGNAT…PWGWW → SSGSEYREKTNENPSMDPSP TKQDFFRNRLALANDLDQGT AV in isoform 2. | VSP_044905 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Exhaustive RT-PCR and sequencing of all novel TWINSCAN predictions in human." Stevens M., Wei C., Gross S.S., McPherson J., Brent M.R. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-83 (ISOFORM 1/2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 747-844 (ISOFORM 2). Tissue: Caudate nucleus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC018693 Genomic DNA. No translation available. AC019171 Genomic DNA. No translation available. DV080278 mRNA. No translation available. AK123375 mRNA. No translation available. |
| IPI | IPI00915871. |
| RefSeq | NP_001138923.2. NM_001145451.2. |
| UniGene | Hs.99841. |
3D structure databases | |
| ProteinModelPortal | A8MVX0. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | A8MVX0. |
Proteomic databases | |
| PaxDb | A8MVX0. |
| PRIDE | A8MVX0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000398800; ENSP00000381780; ENSG00000214694. ENST00000409978; ENSP00000387020; ENSG00000214694. ENST00000536934; ENSP00000445586; ENSG00000214694. |
| GeneID | 100271715. |
| KEGG | hsa:100271715. |
| UCSC | uc021vgd.1. human. |
Organism-specific databases | |
| GeneCards | GC02P039118. |
| HGNC | HGNC:37252. ARHGEF33. |
| HPA | HPA034661. |
| neXtProt | NX_A8MVX0. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG47910. |
| HOGENOM | HOG000168823. |
| HOVERGEN | HBG098090. |
| InParanoid | A8MVX0. |
| OMA | SMAKLYK. |
| OrthoDB | EOG4J3WGC. |
Gene expression databases | |
| ArrayExpress | A8MVX0. |
| Bgee | A8MVX0. |
| Genevestigator | A8MVX0. |
Family and domain databases | |
| Gene3D | 1.20.900.10. 1 hit. |
| InterPro | IPR000219. DH-domain. [Graphical view] |
| Pfam | PF00621. RhoGEF. 1 hit. [Graphical view] |
| SUPFAM | SSF48065. DH-domain. 1 hit. |
| PROSITE | PS00741. DH_1. False negative. PS50010. DH_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 35535224. |
Entry information
| Entry name | ARG33_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A8MVX0 Secondary accession number(s): J3KPX2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
