Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A8MVX0

- ARG33_HUMAN

UniProt

A8MVX0 - ARG33_HUMAN

Protein

Rho guanine nucleotide exchange factor 33

Gene

ARHGEF33

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 50 (01 Oct 2014)
      Sequence version 2 (13 Jul 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as a guanine-nucleotide releasing factor.By similarity

    GO - Molecular functioni

    1. Rho guanyl-nucleotide exchange factor activity Source: InterPro

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rho guanine nucleotide exchange factor 33
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:37252. ARHGEF33.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 844844Rho guanine nucleotide exchange factor 33PRO_0000342343Add
    BLAST

    Proteomic databases

    PaxDbiA8MVX0.
    PRIDEiA8MVX0.

    PTM databases

    PhosphoSiteiA8MVX0.

    Expressioni

    Gene expression databases

    BgeeiA8MVX0.
    GenevestigatoriA8MVX0.

    Organism-specific databases

    HPAiHPA034661.

    Structurei

    3D structure databases

    ProteinModelPortaliA8MVX0.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini265 – 440176DHPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili54 – 12976Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi522 – 5254Poly-Gln
    Compositional biasi750 – 7567Poly-Ala

    Sequence similaritiesi

    Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG47910.
    HOGENOMiHOG000168823.
    HOVERGENiHBG098090.
    InParanoidiA8MVX0.
    OMAiQFCAAEQ.
    OrthoDBiEOG7XH6P4.
    PhylomeDBiA8MVX0.

    Family and domain databases

    Gene3Di1.20.900.10. 1 hit.
    InterProiIPR000219. DH-domain.
    [Graphical view]
    PfamiPF00621. RhoGEF. 1 hit.
    [Graphical view]
    SUPFAMiSSF48065. SSF48065. 1 hit.
    PROSITEiPS50010. DH_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A8MVX0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEKTKTKQGE NEHMPVNNPS TQIYQLQALA SELKTGFTEA MQELSRIQHG    50
    EYALEEKVKS CRCSMEEKVT EMKNSLNYFK EELSNAMSMI QAITSKQEEM 100
    QQKIEQLQQE KRRESRKVKA KKTQKEEHSS QAGPAQAQGS PFRSINIPEP 150
    VLPSEDFTNL LPSQAYEKAQ ESRSVHVGDS NVKGMMGPGV NPTTPEAEEN 200
    LKSCLSADIQ SKGHLPSGMW RQPKDGKEWG EEYVTKDHPD KLKEAGQGRH 250
    SSLENVLCET SLAAKRQTVA LELLESERKY VINISLILKI KATFQGSDGK 300
    RNSKERSLFP GSLRYLVQQH LDLLHALQER VLKWPRQGVL GDLFLKLTND 350
    ENNFLDYYVA YLRDLPECIS LVHVVVLKEG DEEIKSDIYT LFFHIVQRIP 400
    EYLIHLQNVL KFTEQEHPDY YLLLVCVQRL RVFISHYTLL FQCNEDLLIQ 450
    KRKKLKKSSM AKLYKGLASQ CANAGQDASP TAGPEAVRDT GIHSEELLQP 500
    YPSAPSSGPA ITHLMPPVKK SQQQQSLMES MQPGKPSDWE LEGRKHERPE 550
    SLLAPTQFCA AEQDVKALAG PLQAIPEMDF ESSPAEPLGN VERSLRAPAE 600
    LLPDARGFVP AAYEEFEYGG EIFALPAPYD EEPFQAPALF ENCSPASSES 650
    SLDICFLRPV SFAMEAERPE HPLQPLPKSA TSPAGSSSAY KLEAAAQAHG 700
    KAKPLSRSLK EFPRAPPADG VAPRLYSTRS SSGGRAPIKA ERAAQAHGPA 750
    AAAVAARGAS RTFFPQQRSQ SEKQTYLEVR REMHLEDTTR FCPKEERESE 800
    QTSFSDQNPR QDQKGGFRSS FRKLFKKKNG NATGEDFCGP WGWW 844
    Length:844
    Mass (Da):94,633
    Last modified:July 13, 2010 - v2
    Checksum:i790FB919145D5C3E
    GO
    Isoform 2 (identifier: A8MVX0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         829-844: NGNATGEDFCGPWGWW → SSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV

    Note: No experimental confirmation available.

    Show »
    Length:870
    Mass (Da):97,524
    Checksum:i9EA51122954F91BB
    GO

    Sequence cautioni

    The sequence DV080278 differs from that shown. Reason: Frameshift at position 79.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei829 – 84416NGNAT…PWGWW → SSGSEYREKTNENPSMDPSP TKQDFFRNRLALANDLDQGT AV in isoform 2. 1 PublicationVSP_044905Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC018693 Genomic DNA. No translation available.
    AC019171 Genomic DNA. No translation available.
    DV080278 mRNA. No translation available.
    AK123375 mRNA. No translation available.
    CCDSiCCDS46263.2. [A8MVX0-2]
    RefSeqiNP_001138923.2. NM_001145451.2. [A8MVX0-2]
    UniGeneiHs.99841.

    Genome annotation databases

    EnsembliENST00000398800; ENSP00000381780; ENSG00000214694. [A8MVX0-2]
    ENST00000409978; ENSP00000387020; ENSG00000214694. [A8MVX0-2]
    GeneIDi100271715.
    KEGGihsa:100271715.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC018693 Genomic DNA. No translation available.
    AC019171 Genomic DNA. No translation available.
    DV080278 mRNA. No translation available.
    AK123375 mRNA. No translation available.
    CCDSi CCDS46263.2. [A8MVX0-2 ]
    RefSeqi NP_001138923.2. NM_001145451.2. [A8MVX0-2 ]
    UniGenei Hs.99841.

    3D structure databases

    ProteinModelPortali A8MVX0.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei A8MVX0.

    Proteomic databases

    PaxDbi A8MVX0.
    PRIDEi A8MVX0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000398800 ; ENSP00000381780 ; ENSG00000214694 . [A8MVX0-2 ]
    ENST00000409978 ; ENSP00000387020 ; ENSG00000214694 . [A8MVX0-2 ]
    GeneIDi 100271715.
    KEGGi hsa:100271715.

    Organism-specific databases

    CTDi 100271715.
    GeneCardsi GC02P039118.
    HGNCi HGNC:37252. ARHGEF33.
    HPAi HPA034661.
    neXtProti NX_A8MVX0.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47910.
    HOGENOMi HOG000168823.
    HOVERGENi HBG098090.
    InParanoidi A8MVX0.
    OMAi QFCAAEQ.
    OrthoDBi EOG7XH6P4.
    PhylomeDBi A8MVX0.

    Miscellaneous databases

    NextBioi 35535224.
    PROi A8MVX0.

    Gene expression databases

    Bgeei A8MVX0.
    Genevestigatori A8MVX0.

    Family and domain databases

    Gene3Di 1.20.900.10. 1 hit.
    InterProi IPR000219. DH-domain.
    [Graphical view ]
    Pfami PF00621. RhoGEF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48065. SSF48065. 1 hit.
    PROSITEi PS50010. DH_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "Exhaustive RT-PCR and sequencing of all novel TWINSCAN predictions in human."
      Stevens M., Wei C., Gross S.S., McPherson J., Brent M.R.
      Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-83 (ISOFORM 1/2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 747-844 (ISOFORM 2).
      Tissue: Caudate nucleus.

    Entry informationi

    Entry nameiARG33_HUMAN
    AccessioniPrimary (citable) accession number: A8MVX0
    Secondary accession number(s): J3KPX2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 2008
    Last sequence update: July 13, 2010
    Last modified: October 1, 2014
    This is version 50 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3