Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A8MVX0 (ARG33_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 49. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Rho guanine nucleotide exchange factor 33
Gene names
Name:ARHGEF33
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length844 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May act as a guanine-nucleotide releasing factor By similarity.

Sequence similarities

Contains 1 DH (DBL-homology) domain.

Sequence caution

The sequence DV080278 differs from that shown. Reason: Frameshift at position 79.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   Molecular functionGuanine-nucleotide releasing factor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Molecular_functionRho guanyl-nucleotide exchange factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A8MVX0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A8MVX0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     829-844: NGNATGEDFCGPWGWW → SSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 844844Rho guanine nucleotide exchange factor 33
PRO_0000342343

Regions

Domain265 – 440176DH
Coiled coil54 – 12976 Potential
Compositional bias522 – 5254Poly-Gln
Compositional bias750 – 7567Poly-Ala

Natural variations

Alternative sequence829 – 84416NGNAT…PWGWW → SSGSEYREKTNENPSMDPSP TKQDFFRNRLALANDLDQGT AV in isoform 2.
VSP_044905

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 13, 2010. Version 2.
Checksum: 790FB919145D5C3E

FASTA84494,633
        10         20         30         40         50         60 
MEKTKTKQGE NEHMPVNNPS TQIYQLQALA SELKTGFTEA MQELSRIQHG EYALEEKVKS 

        70         80         90        100        110        120 
CRCSMEEKVT EMKNSLNYFK EELSNAMSMI QAITSKQEEM QQKIEQLQQE KRRESRKVKA 

       130        140        150        160        170        180 
KKTQKEEHSS QAGPAQAQGS PFRSINIPEP VLPSEDFTNL LPSQAYEKAQ ESRSVHVGDS 

       190        200        210        220        230        240 
NVKGMMGPGV NPTTPEAEEN LKSCLSADIQ SKGHLPSGMW RQPKDGKEWG EEYVTKDHPD 

       250        260        270        280        290        300 
KLKEAGQGRH SSLENVLCET SLAAKRQTVA LELLESERKY VINISLILKI KATFQGSDGK 

       310        320        330        340        350        360 
RNSKERSLFP GSLRYLVQQH LDLLHALQER VLKWPRQGVL GDLFLKLTND ENNFLDYYVA 

       370        380        390        400        410        420 
YLRDLPECIS LVHVVVLKEG DEEIKSDIYT LFFHIVQRIP EYLIHLQNVL KFTEQEHPDY 

       430        440        450        460        470        480 
YLLLVCVQRL RVFISHYTLL FQCNEDLLIQ KRKKLKKSSM AKLYKGLASQ CANAGQDASP 

       490        500        510        520        530        540 
TAGPEAVRDT GIHSEELLQP YPSAPSSGPA ITHLMPPVKK SQQQQSLMES MQPGKPSDWE 

       550        560        570        580        590        600 
LEGRKHERPE SLLAPTQFCA AEQDVKALAG PLQAIPEMDF ESSPAEPLGN VERSLRAPAE 

       610        620        630        640        650        660 
LLPDARGFVP AAYEEFEYGG EIFALPAPYD EEPFQAPALF ENCSPASSES SLDICFLRPV 

       670        680        690        700        710        720 
SFAMEAERPE HPLQPLPKSA TSPAGSSSAY KLEAAAQAHG KAKPLSRSLK EFPRAPPADG 

       730        740        750        760        770        780 
VAPRLYSTRS SSGGRAPIKA ERAAQAHGPA AAAVAARGAS RTFFPQQRSQ SEKQTYLEVR 

       790        800        810        820        830        840 
REMHLEDTTR FCPKEERESE QTSFSDQNPR QDQKGGFRSS FRKLFKKKNG NATGEDFCGP 


WGWW 

« Hide

Isoform 2 [UniParc].

Checksum: 9EA51122954F91BB
Show »

FASTA87097,524

References

[1]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"Exhaustive RT-PCR and sequencing of all novel TWINSCAN predictions in human."
Stevens M., Wei C., Gross S.S., McPherson J., Brent M.R.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-83 (ISOFORM 1/2).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 747-844 (ISOFORM 2).
Tissue: Caudate nucleus.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC018693 Genomic DNA. No translation available.
AC019171 Genomic DNA. No translation available.
DV080278 mRNA. No translation available.
AK123375 mRNA. No translation available.
CCDSCCDS46263.2. [A8MVX0-2]
RefSeqNP_001138923.2. NM_001145451.2. [A8MVX0-2]
UniGeneHs.99841.

3D structure databases

ProteinModelPortalA8MVX0.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteA8MVX0.

Proteomic databases

PaxDbA8MVX0.
PRIDEA8MVX0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000398800; ENSP00000381780; ENSG00000214694. [A8MVX0-2]
ENST00000409978; ENSP00000387020; ENSG00000214694. [A8MVX0-2]
ENST00000536934; ENSP00000445586; ENSG00000214694. [A8MVX0-1]
GeneID100271715.
KEGGhsa:100271715.

Organism-specific databases

CTD100271715.
GeneCardsGC02P039118.
HGNCHGNC:37252. ARHGEF33.
HPAHPA034661.
neXtProtNX_A8MVX0.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG47910.
HOGENOMHOG000168823.
HOVERGENHBG098090.
InParanoidA8MVX0.
OMAQFCAAEQ.
OrthoDBEOG7XH6P4.
PhylomeDBA8MVX0.

Gene expression databases

BgeeA8MVX0.
GenevestigatorA8MVX0.

Family and domain databases

Gene3D1.20.900.10. 1 hit.
InterProIPR000219. DH-domain.
[Graphical view]
PfamPF00621. RhoGEF. 1 hit.
[Graphical view]
SUPFAMSSF48065. SSF48065. 1 hit.
PROSITEPS50010. DH_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio35535224.
PROA8MVX0.

Entry information

Entry nameARG33_HUMAN
AccessionPrimary (citable) accession number: A8MVX0
Secondary accession number(s): J3KPX2
Entry history
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 13, 2010
Last modified: July 9, 2014
This is version 49 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM