Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 33

Gene

ARHGEF33

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

May act as a guanine-nucleotide releasing factor.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 33
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:37252. ARHGEF33.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000214694.

Polymorphism and mutation databases

BioMutaiARHGEF33.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003423431 – 844Rho guanine nucleotide exchange factor 33Add BLAST844

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei757Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation

Proteomic databases

PaxDbiA8MVX0.
PRIDEiA8MVX0.

PTM databases

iPTMnetiA8MVX0.
PhosphoSitePlusiA8MVX0.

Expressioni

Gene expression databases

BgeeiENSG00000214694.
ExpressionAtlasiA8MVX0. baseline and differential.

Organism-specific databases

HPAiHPA034661.

Interactioni

Protein-protein interaction databases

BioGridi938496. 2 interactors.
STRINGi9606.ENSP00000381780.

Structurei

3D structure databases

ProteinModelPortaliA8MVX0.
SMRiA8MVX0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini265 – 440DHPROSITE-ProRule annotationAdd BLAST176

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili54 – 129Sequence analysisAdd BLAST76

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi522 – 525Poly-Gln4
Compositional biasi750 – 756Poly-Ala7

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJAS. Eukaryota.
ENOG4111MU9. LUCA.
GeneTreeiENSGT00390000006230.
HOGENOMiHOG000168823.
HOVERGENiHBG098090.
InParanoidiA8MVX0.
OMAiQFCAAEQ.
OrthoDBiEOG091G026K.
PhylomeDBiA8MVX0.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
InterProiIPR000219. DH-domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A8MVX0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKTKTKQGE NEHMPVNNPS TQIYQLQALA SELKTGFTEA MQELSRIQHG
60 70 80 90 100
EYALEEKVKS CRCSMEEKVT EMKNSLNYFK EELSNAMSMI QAITSKQEEM
110 120 130 140 150
QQKIEQLQQE KRRESRKVKA KKTQKEEHSS QAGPAQAQGS PFRSINIPEP
160 170 180 190 200
VLPSEDFTNL LPSQAYEKAQ ESRSVHVGDS NVKGMMGPGV NPTTPEAEEN
210 220 230 240 250
LKSCLSADIQ SKGHLPSGMW RQPKDGKEWG EEYVTKDHPD KLKEAGQGRH
260 270 280 290 300
SSLENVLCET SLAAKRQTVA LELLESERKY VINISLILKI KATFQGSDGK
310 320 330 340 350
RNSKERSLFP GSLRYLVQQH LDLLHALQER VLKWPRQGVL GDLFLKLTND
360 370 380 390 400
ENNFLDYYVA YLRDLPECIS LVHVVVLKEG DEEIKSDIYT LFFHIVQRIP
410 420 430 440 450
EYLIHLQNVL KFTEQEHPDY YLLLVCVQRL RVFISHYTLL FQCNEDLLIQ
460 470 480 490 500
KRKKLKKSSM AKLYKGLASQ CANAGQDASP TAGPEAVRDT GIHSEELLQP
510 520 530 540 550
YPSAPSSGPA ITHLMPPVKK SQQQQSLMES MQPGKPSDWE LEGRKHERPE
560 570 580 590 600
SLLAPTQFCA AEQDVKALAG PLQAIPEMDF ESSPAEPLGN VERSLRAPAE
610 620 630 640 650
LLPDARGFVP AAYEEFEYGG EIFALPAPYD EEPFQAPALF ENCSPASSES
660 670 680 690 700
SLDICFLRPV SFAMEAERPE HPLQPLPKSA TSPAGSSSAY KLEAAAQAHG
710 720 730 740 750
KAKPLSRSLK EFPRAPPADG VAPRLYSTRS SSGGRAPIKA ERAAQAHGPA
760 770 780 790 800
AAAVAARGAS RTFFPQQRSQ SEKQTYLEVR REMHLEDTTR FCPKEERESE
810 820 830 840
QTSFSDQNPR QDQKGGFRSS FRKLFKKKNG NATGEDFCGP WGWW
Length:844
Mass (Da):94,633
Last modified:July 13, 2010 - v2
Checksum:i790FB919145D5C3E
GO
Isoform 2 (identifier: A8MVX0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     829-844: NGNATGEDFCGPWGWW → SSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV

Note: No experimental confirmation available.
Show »
Length:870
Mass (Da):97,524
Checksum:i9EA51122954F91BB
GO

Sequence cautioni

The sequence DV080278 differs from that shown. Reason: Frameshift at position 79.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044905829 – 844NGNAT…PWGWW → SSGSEYREKTNENPSMDPSP TKQDFFRNRLALANDLDQGT AV in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC018693 Genomic DNA. No translation available.
AC019171 Genomic DNA. No translation available.
DV080278 mRNA. No translation available.
AK123375 mRNA. No translation available.
CCDSiCCDS46263.2. [A8MVX0-2]
RefSeqiNP_001138923.2. NM_001145451.2. [A8MVX0-2]
UniGeneiHs.99841.

Genome annotation databases

EnsembliENST00000398800; ENSP00000381780; ENSG00000214694. [A8MVX0-2]
ENST00000409978; ENSP00000387020; ENSG00000214694. [A8MVX0-2]
GeneIDi100271715.
KEGGihsa:100271715.
UCSCiuc021vgd.2. human. [A8MVX0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC018693 Genomic DNA. No translation available.
AC019171 Genomic DNA. No translation available.
DV080278 mRNA. No translation available.
AK123375 mRNA. No translation available.
CCDSiCCDS46263.2. [A8MVX0-2]
RefSeqiNP_001138923.2. NM_001145451.2. [A8MVX0-2]
UniGeneiHs.99841.

3D structure databases

ProteinModelPortaliA8MVX0.
SMRiA8MVX0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi938496. 2 interactors.
STRINGi9606.ENSP00000381780.

PTM databases

iPTMnetiA8MVX0.
PhosphoSitePlusiA8MVX0.

Polymorphism and mutation databases

BioMutaiARHGEF33.

Proteomic databases

PaxDbiA8MVX0.
PRIDEiA8MVX0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000398800; ENSP00000381780; ENSG00000214694. [A8MVX0-2]
ENST00000409978; ENSP00000387020; ENSG00000214694. [A8MVX0-2]
GeneIDi100271715.
KEGGihsa:100271715.
UCSCiuc021vgd.2. human. [A8MVX0-1]

Organism-specific databases

CTDi100271715.
GeneCardsiARHGEF33.
HGNCiHGNC:37252. ARHGEF33.
HPAiHPA034661.
neXtProtiNX_A8MVX0.
OpenTargetsiENSG00000214694.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJAS. Eukaryota.
ENOG4111MU9. LUCA.
GeneTreeiENSGT00390000006230.
HOGENOMiHOG000168823.
HOVERGENiHBG098090.
InParanoidiA8MVX0.
OMAiQFCAAEQ.
OrthoDBiEOG091G026K.
PhylomeDBiA8MVX0.

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Miscellaneous databases

GenomeRNAii100271715.
PROiA8MVX0.

Gene expression databases

BgeeiENSG00000214694.
ExpressionAtlasiA8MVX0. baseline and differential.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
InterProiIPR000219. DH-domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARG33_HUMAN
AccessioniPrimary (citable) accession number: A8MVX0
Secondary accession number(s): J3KPX2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 13, 2010
Last modified: November 30, 2016
This is version 66 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.