Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serpin E3

Gene

SERPINE3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable serine protease inhibitor.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei369 – 3702Reactive bondSequence analysis

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Protease inhibitor, Serine protease inhibitor

Protein family/group databases

MEROPSiI04.972.

Names & Taxonomyi

Protein namesi
Recommended name:
Serpin E3
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:24774. SERPINE3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164725650.

Polymorphism and mutation databases

BioMutaiSERPINE3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence analysisAdd
BLAST
Chaini21 – 424404Serpin E3PRO_0000340684Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi46 – 461N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA8MV23.
PRIDEiA8MV23.
TopDownProteomicsiA8MV23-1. [A8MV23-1]

PTM databases

iPTMnetiA8MV23.

Expressioni

Gene expression databases

BgeeiA8MV23.
CleanExiHS_SERPINE3.
ExpressionAtlasiA8MV23. baseline and differential.

Organism-specific databases

HPAiHPA051904.
HPA055804.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000428316.

Structurei

3D structure databases

ProteinModelPortaliA8MV23.
SMRiA8MV23. Positions 29-399.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the serpin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG2392. Eukaryota.
COG4826. LUCA.
GeneTreeiENSGT00840000129734.
HOGENOMiHOG000154290.
HOVERGENiHBG108474.
InParanoidiA8MV23.
OMAiSRWANSS.
OrthoDBiEOG7327PB.
PhylomeDBiA8MV23.
TreeFamiTF352620.

Family and domain databases

InterProiIPR023795. Serpin_CS.
IPR023796. Serpin_dom.
IPR031172. Serpin_E3.
IPR000215. Serpin_fam.
[Graphical view]
PANTHERiPTHR11461. PTHR11461. 1 hit.
PTHR11461:SF129. PTHR11461:SF129. 1 hit.
PfamiPF00079. Serpin. 1 hit.
[Graphical view]
SMARTiSM00093. SERPIN. 1 hit.
[Graphical view]
SUPFAMiSSF56574. SSF56574. 1 hit.
PROSITEiPS00284. SERPIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A8MV23-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPFLITLFL FHSCCLRANG HLREGMTLLK TEFALHLYQS VAACRNETNF
60 70 80 90 100
VISPAGVSLP LEILQFGAEG STGQQLADAL GYTVHDKRVK DFLHAVYATL
110 120 130 140 150
PTSSQGTEME LACSLFVQVG TPLSPCFVEH VSWWANSSLE PADLSEPNST
160 170 180 190 200
AIQTSEGASR ETAGGGPSEG PGGWPWEQVS AAFAQLVLVS TMSFQGTWRK
210 220 230 240 250
RFSSTDTQIL PFTCAYGLVL QVPMMHQTTE VNYGQFQDTA GHQVGVLELP
260 270 280 290 300
YLGSAVSLFL VLPRDKDTPL SHIEPHLTAS TIHLWTTSLR RARMDVFLPR
310 320 330 340 350
FRIQNQFNLK SILNSWGVTD LFDPLKANLK GISGQDGFYV SEAIHKAKIE
360 370 380 390 400
VLEEGTKASG ATALLLLKRS RIPIFKADRP FIYFLREPNT GITVFFDRIQ
410 420
IIYQCLSSNK GSFVHYPLKN KHSF
Length:424
Mass (Da):46,963
Last modified:June 10, 2008 - v2
Checksum:i5B28DBB3317B4B1B
GO
Isoform 2 (identifier: A8MV23-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-424: ITVFFDRIQIIYQCLSSNKGSFVHYPLKNKHSF → FVFSIGRVSNPLD

Show »
Length:404
Mass (Da):44,482
Checksum:iFCBCDA837269A8D1
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti143 – 1431D → N.
Corresponds to variant rs17790811 [ dbSNP | Ensembl ].
VAR_044021

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei392 – 42433ITVFF…NKHSF → FVFSIGRVSNPLD in isoform 2. 1 PublicationVSP_037586Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AX772926 mRNA. Translation: CAE06272.1.
AM402969 mRNA. Translation: CAL47031.1.
AL137780 Genomic DNA. No translation available.
CH471075 Genomic DNA. Translation: EAX08871.1.
CCDSiCCDS53870.1. [A8MV23-1]
RefSeqiNP_001094790.1. NM_001101320.1. [A8MV23-1]
XP_011533504.1. XM_011535202.1. [A8MV23-1]
UniGeneiHs.685891.

Genome annotation databases

EnsembliENST00000400389; ENSP00000441468; ENSG00000253309. [A8MV23-2]
ENST00000521255; ENSP00000428316; ENSG00000253309. [A8MV23-1]
ENST00000524365; ENSP00000430755; ENSG00000253309. [A8MV23-2]
GeneIDi647174.
KEGGihsa:647174.
UCSCiuc001vfh.3. human. [A8MV23-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AX772926 mRNA. Translation: CAE06272.1.
AM402969 mRNA. Translation: CAL47031.1.
AL137780 Genomic DNA. No translation available.
CH471075 Genomic DNA. Translation: EAX08871.1.
CCDSiCCDS53870.1. [A8MV23-1]
RefSeqiNP_001094790.1. NM_001101320.1. [A8MV23-1]
XP_011533504.1. XM_011535202.1. [A8MV23-1]
UniGeneiHs.685891.

3D structure databases

ProteinModelPortaliA8MV23.
SMRiA8MV23. Positions 29-399.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000428316.

Protein family/group databases

MEROPSiI04.972.

PTM databases

iPTMnetiA8MV23.

Polymorphism and mutation databases

BioMutaiSERPINE3.

Proteomic databases

PaxDbiA8MV23.
PRIDEiA8MV23.
TopDownProteomicsiA8MV23-1. [A8MV23-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000400389; ENSP00000441468; ENSG00000253309. [A8MV23-2]
ENST00000521255; ENSP00000428316; ENSG00000253309. [A8MV23-1]
ENST00000524365; ENSP00000430755; ENSG00000253309. [A8MV23-2]
GeneIDi647174.
KEGGihsa:647174.
UCSCiuc001vfh.3. human. [A8MV23-1]

Organism-specific databases

CTDi647174.
GeneCardsiSERPINE3.
HGNCiHGNC:24774. SERPINE3.
HPAiHPA051904.
HPA055804.
neXtProtiNX_A8MV23.
PharmGKBiPA164725650.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2392. Eukaryota.
COG4826. LUCA.
GeneTreeiENSGT00840000129734.
HOGENOMiHOG000154290.
HOVERGENiHBG108474.
InParanoidiA8MV23.
OMAiSRWANSS.
OrthoDBiEOG7327PB.
PhylomeDBiA8MV23.
TreeFamiTF352620.

Miscellaneous databases

GenomeRNAii647174.
PROiA8MV23.

Gene expression databases

BgeeiA8MV23.
CleanExiHS_SERPINE3.
ExpressionAtlasiA8MV23. baseline and differential.

Family and domain databases

InterProiIPR023795. Serpin_CS.
IPR023796. Serpin_dom.
IPR031172. Serpin_E3.
IPR000215. Serpin_fam.
[Graphical view]
PANTHERiPTHR11461. PTHR11461. 1 hit.
PTHR11461:SF129. PTHR11461:SF129. 1 hit.
PfamiPF00079. Serpin. 1 hit.
[Graphical view]
SMARTiSM00093. SERPIN. 1 hit.
[Graphical view]
SUPFAMiSSF56574. SSF56574. 1 hit.
PROSITEiPS00284. SERPIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Polynucleotides encoding nexin-related serine protease inhibitor."
    Smolyar A.
    Patent number WO03046006, 05-JUN-2003
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Identification and characterization of a novel human serpin."
    Bentele C., Ragg H.
    Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiSERP3_HUMAN
AccessioniPrimary (citable) accession number: A8MV23
Secondary accession number(s): B1V8P3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: June 8, 2016
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.