Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serpin E3

Gene

SERPINE3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Probable serine protease inhibitor.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei369 – 370Reactive bondSequence analysis2

GO - Molecular functioni

Keywordsi

Molecular functionProtease inhibitor, Serine protease inhibitor

Protein family/group databases

MEROPSiI04.972

Names & Taxonomyi

Protein namesi
Recommended name:
Serpin E3
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000253309.6
HGNCiHGNC:24774 SERPINE3
neXtProtiNX_A8MV23

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000253309
PharmGKBiPA164725650

Polymorphism and mutation databases

BioMutaiSERPINE3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
ChainiPRO_000034068421 – 424Serpin E3Add BLAST404

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi46N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA8MV23
PRIDEiA8MV23
TopDownProteomicsiA8MV23-1 [A8MV23-1]

PTM databases

iPTMnetiA8MV23
PhosphoSitePlusiA8MV23

Expressioni

Gene expression databases

BgeeiENSG00000253309
CleanExiHS_SERPINE3
ExpressionAtlasiA8MV23 baseline and differential

Organism-specific databases

HPAiHPA051904
HPA055804

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000428316

Structurei

3D structure databases

ProteinModelPortaliA8MV23
SMRiA8MV23
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the serpin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG2392 Eukaryota
COG4826 LUCA
GeneTreeiENSGT00900000140788
HOGENOMiHOG000154290
HOVERGENiHBG108474
InParanoidiA8MV23
OMAiVSRWANS
OrthoDBiEOG091G0ION
PhylomeDBiA8MV23
TreeFamiTF352620

Family and domain databases

InterProiView protein in InterPro
IPR023795 Serpin_CS
IPR023796 Serpin_dom
IPR031172 Serpin_E3
IPR000215 Serpin_fam
IPR036186 Serpin_sf
PANTHERiPTHR11461 PTHR11461, 1 hit
PTHR11461:SF129 PTHR11461:SF129, 1 hit
PfamiView protein in Pfam
PF00079 Serpin, 1 hit
SMARTiView protein in SMART
SM00093 SERPIN, 1 hit
SUPFAMiSSF56574 SSF56574, 1 hit
PROSITEiView protein in PROSITE
PS00284 SERPIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A8MV23-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPFLITLFL FHSCCLRANG HLREGMTLLK TEFALHLYQS VAACRNETNF
60 70 80 90 100
VISPAGVSLP LEILQFGAEG STGQQLADAL GYTVHDKRVK DFLHAVYATL
110 120 130 140 150
PTSSQGTEME LACSLFVQVG TPLSPCFVEH VSWWANSSLE PADLSEPNST
160 170 180 190 200
AIQTSEGASR ETAGGGPSEG PGGWPWEQVS AAFAQLVLVS TMSFQGTWRK
210 220 230 240 250
RFSSTDTQIL PFTCAYGLVL QVPMMHQTTE VNYGQFQDTA GHQVGVLELP
260 270 280 290 300
YLGSAVSLFL VLPRDKDTPL SHIEPHLTAS TIHLWTTSLR RARMDVFLPR
310 320 330 340 350
FRIQNQFNLK SILNSWGVTD LFDPLKANLK GISGQDGFYV SEAIHKAKIE
360 370 380 390 400
VLEEGTKASG ATALLLLKRS RIPIFKADRP FIYFLREPNT GITVFFDRIQ
410 420
IIYQCLSSNK GSFVHYPLKN KHSF
Length:424
Mass (Da):46,963
Last modified:June 10, 2008 - v2
Checksum:i5B28DBB3317B4B1B
GO
Isoform 2 (identifier: A8MV23-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-424: ITVFFDRIQIIYQCLSSNKGSFVHYPLKNKHSF → FVFSIGRVSNPLD

Show »
Length:404
Mass (Da):44,482
Checksum:iFCBCDA837269A8D1
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_044021143D → N. Corresponds to variant dbSNP:rs17790811Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_037586392 – 424ITVFF…NKHSF → FVFSIGRVSNPLD in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AX772926 mRNA Translation: CAE06272.1
AM402969 mRNA Translation: CAL47031.1
AL137780 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08871.1
CCDSiCCDS53870.1 [A8MV23-1]
RefSeqiNP_001094790.1, NM_001101320.1 [A8MV23-1]
UniGeneiHs.685891

Genome annotation databases

EnsembliENST00000400389; ENSP00000441468; ENSG00000253309 [A8MV23-2]
ENST00000521255; ENSP00000428316; ENSG00000253309 [A8MV23-1]
ENST00000524365; ENSP00000430755; ENSG00000253309 [A8MV23-2]
GeneIDi647174
KEGGihsa:647174
UCSCiuc001vfh.3 human [A8MV23-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSERP3_HUMAN
AccessioniPrimary (citable) accession number: A8MV23
Secondary accession number(s): B1V8P3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: April 25, 2018
This is version 86 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health