A8MT70 (ZBBX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 37.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger B-box domain-containing protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 800 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 1 B box-type zinc finger. |
| Sequence caution | The sequence BAB15532.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A8MT70-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: A8MT70-2) The sequence of this isoform differs from the canonical sequence as follows: 626-626: A → AEDREWIPDHSLSEYADNAIVLGVLQGAQSPSSSRKQQKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 800 | 800 | Zinc finger B-box domain-containing protein 1 | PRO_0000325813 | |||||
Regions | |||||||||
| Zinc finger | 129 – 175 | 47 | B box-type; atypical | ||||||
| Coiled coil | 21 – 64 | 44 | Potential | ||||||
| Coiled coil | 693 – 720 | 28 | Potential | ||||||
| Compositional bias | 641 – 674 | 34 | Ser-rich | ||||||
| Compositional bias | 780 – 783 | 4 | Poly-Glu | ||||||
Natural variations | |||||||||
| Alternative sequence | 626 | 1 | A → AEDREWIPDHSLSEYADNAI VLGVLQGAQSPSSSRKQQKM in isoform 2. | VSP_035573 | |||||
| Natural variant | 14 | 1 | P → T. Corresponds to variant rs10936535 [ dbSNP | Ensembl ]. | VAR_048400 | |||||
| Natural variant | 160 | 1 | K → N. Corresponds to variant rs4619784 [ dbSNP | Ensembl ]. | VAR_048401 | |||||
| Natural variant | 178 | 1 | K → R. Corresponds to variant rs11923054 [ dbSNP | Ensembl ]. | VAR_048402 | |||||
| Natural variant | 346 | 1 | H → R. Corresponds to variant rs34465133 [ dbSNP | Ensembl ]. | VAR_061040 | |||||
| Natural variant | 473 | 1 | A → G. Ref.2 Corresponds to variant rs13096767 [ dbSNP | Ensembl ]. | VAR_048403 | |||||
| Natural variant | 511 | 1 | I → T. Corresponds to variant rs35190925 [ dbSNP | Ensembl ]. | VAR_048404 | |||||
| Natural variant | 555 | 1 | E → K. Corresponds to variant rs35864545 [ dbSNP | Ensembl ]. | VAR_048405 | |||||
| Natural variant | 636 | 1 | A → G. Ref.2 Corresponds to variant rs12638625 [ dbSNP | Ensembl ]. | VAR_046955 | |||||
Experimental info | |||||||||
| Sequence conflict | 273 | 1 | N → K in BAB15532. Ref.2 | ||||||
| Sequence conflict | 339 | 1 | P → S in BAB15532. Ref.2 | ||||||
| Sequence conflict | 576 | 1 | L → S in BAG52683. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 273-800 (ISOFORM 2), VARIANTS GLY-473 AND GLY-636. Tissue: Lung and Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC107311 Genomic DNA. No translation available. AC117463 Genomic DNA. No translation available. AK026702 mRNA. Translation: BAB15532.1. Different initiation. AK093296 mRNA. Translation: BAG52683.1. |
| IPI | IPI00002975. IPI00796568. |
| RefSeq | NP_078963.2. NM_024687.3. |
| UniGene | Hs.478143. |
3D structure databases | |
| ProteinModelPortal | A8MT70. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | A8MT70. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000392766; ENSP00000376519; ENSG00000169064. ENST00000392767; ENSP00000376520; ENSG00000169064. |
| GeneID | 79740. |
| KEGG | hsa:79740. |
| UCSC | uc003feo.1. human. |
Organism-specific databases | |
| CTD | 79740. |
| GeneCards | GC03M166958. |
| HGNC | HGNC:26245. ZBBX. |
| HPA | HPA036327. |
| neXtProt | NX_A8MT70. |
| PharmGKB | PA162409400. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18065. |
| HOVERGEN | HBG106618. |
| InParanoid | A8MT70. |
| OMA | DVAHQFI. |
| OrthoDB | EOG479F6T. |
Gene expression databases | |
| Bgee | A8MT70. |
| CleanEx | HS_ZBBX. |
| Genevestigator | A8MT70. |
Family and domain databases | |
| InterPro | IPR000315. Znf_B-box. [Graphical view] |
| Pfam | PF00643. zf-B_box. 1 hit. [Graphical view] |
| PROSITE | PS50119. ZF_BBOX. False negative. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | ZBBX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A8MT70 Secondary accession number(s): A8MV69 Q9H5T8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with