Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger B-box domain-containing protein 1

Gene

ZBBX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri129 – 175B box-type; atypicalAdd BLAST47

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger B-box domain-containing protein 1
Gene namesi
Name:ZBBX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:26245. ZBBX.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi79740.
OpenTargetsiENSG00000169064.
PharmGKBiPA162409400.

Polymorphism and mutation databases

BioMutaiZBBX.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003258131 – 800Zinc finger B-box domain-containing protein 1Add BLAST800

Proteomic databases

PaxDbiA8MT70.
PRIDEiA8MT70.

PTM databases

iPTMnetiA8MT70.
PhosphoSitePlusiA8MT70.

Expressioni

Gene expression databases

BgeeiENSG00000169064.
CleanExiHS_ZBBX.
ExpressionAtlasiA8MT70. baseline and differential.
GenevisibleiA8MT70. HS.

Organism-specific databases

HPAiHPA036327.
HPA036328.

Interactioni

Protein-protein interaction databases

BioGridi122853. 25 interactors.

Structurei

3D structure databases

ProteinModelPortaliA8MT70.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili21 – 64Sequence analysisAdd BLAST44
Coiled coili693 – 720Sequence analysisAdd BLAST28

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi641 – 674Ser-richAdd BLAST34
Compositional biasi780 – 783Poly-Glu4

Sequence similaritiesi

Contains 1 B box-type zinc finger.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri129 – 175B box-type; atypicalAdd BLAST47

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IVIG. Eukaryota.
ENOG4111KT9. LUCA.
GeneTreeiENSGT00390000018298.
HOGENOMiHOG000136319.
HOVERGENiHBG106618.
InParanoidiA8MT70.
OMAiHRRTPQE.
OrthoDBiEOG091G0RPO.
PhylomeDBiA8MT70.
TreeFamiTF337517.

Family and domain databases

InterProiIPR000315. Znf_B-box.
[Graphical view]
PfamiPF00643. zf-B_box. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A8MT70-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRKDFVVLP WGKPGNSVKL KYRNAQELRM EKVQLEFENQ EMEKKLQEFR
60 70 80 90 100
STRNKEKEDR ESSEYYWKSG KVGKLVNQSY MMSQNKGNVV KFSAGKVKLK
110 120 130 140 150
LLKEQIQEPV KPTVNYKMAN SSECEKPKIN GKVCGQCENK AALLVCLECG
160 170 180 190 200
EDYCSGCFAK VHQKGALKLH RTTLLQAKSQ ILFNVLDVAH QFIKDVNPDE
210 220 230 240 250
PKEENNSTKE TSKIQHKPKS VLLQRSSSEV EITTMKRAQR TKPRKSLLCE
260 270 280 290 300
GSFDEEASAQ SFQEVLSQWR TGNHDDNKKQ NLHAAVKDSL EECEVQTNLK
310 320 330 340 350
IWREPLNIEL KEDILSYMEK LWLKKHRRTP QEQLFKMLPD TFPHPHETTG
360 370 380 390 400
DAQCSQNEND EDSDGEETKV QHTALLLPVE TLNIERPEPS LKIVELDDTY
410 420 430 440 450
EEEFEEAENI VPYKVKLADA DSQRSCAFHD CQKNSFPYEN GIHQHHVFDK
460 470 480 490 500
GKRDFLNLCL RNSSTYYKDN SKAETSNTDF DNIVDPDVYS SDIEKIEEST
510 520 530 540 550
SFERNLKEKN IGLESNQKSD DSCVSLESKD TLLGRDLEKA PIEEKLSQDI
560 570 580 590 600
KESLELSNLY KRPSFEESKT TKSSLLLQEI ACRSKPITKQ YQGLERFFIF
610 620 630 640 650
DTNERLNLLP SHRLECNNSS TRITLAGQKS QRPSTANFPL SNSVKESSSC
660 670 680 690 700
LSSSHPRSRS AAAQSSSRAA SEISEIEYID ITDQNELSLD DTTDQHTLDN
710 720 730 740 750
LEKELQVLRS LADTSEKLYS LTSEEFPDFS SQSLNISQIS TDFLKTSHVR
760 770 780 790 800
GPCGVEELSC SGRDTKIQSL LSLSESSTDE EEEDFLNKQH VITLPWSKST
Note: No experimental confirmation available.
Length:800
Mass (Da):91,426
Last modified:October 14, 2008 - v3
Checksum:iD008D3C3D4DE00C3
GO
Isoform 3 (identifier: A8MT70-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: Missing.

Note: No experimental confirmation available.
Show »
Length:771
Mass (Da):87,999
Checksum:iDA50F4C1E52A1733
GO
Isoform 2 (identifier: A8MT70-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-626: A → AEDREWIPDHSLSEYADNAIVLGVLQGAQSPSSSRKQQKM

Note: No experimental confirmation available.
Show »
Length:839
Mass (Da):95,780
Checksum:i2D736A0DA7314002
GO

Sequence cautioni

The sequence BAB15532 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti273N → K in BAB15532 (PubMed:14702039).Curated1
Sequence conflicti339P → S in BAB15532 (PubMed:14702039).Curated1
Sequence conflicti576L → S in BAG52683 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04840014P → T.Corresponds to variant rs10936535dbSNPEnsembl.1
Natural variantiVAR_048401160K → N.Corresponds to variant rs4619784dbSNPEnsembl.1
Natural variantiVAR_048402178K → R.Corresponds to variant rs11923054dbSNPEnsembl.1
Natural variantiVAR_061040346H → R.Corresponds to variant rs34465133dbSNPEnsembl.1
Natural variantiVAR_048403473A → G.1 PublicationCorresponds to variant rs13096767dbSNPEnsembl.1
Natural variantiVAR_048404511I → T.Corresponds to variant rs35190925dbSNPEnsembl.1
Natural variantiVAR_048405555E → K.Corresponds to variant rs35864545dbSNPEnsembl.1
Natural variantiVAR_046955636A → G.1 PublicationCorresponds to variant rs12638625dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548511 – 29Missing in isoform 3. CuratedAdd BLAST29
Alternative sequenceiVSP_035573626A → AEDREWIPDHSLSEYADNAI VLGVLQGAQSPSSSRKQQKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC107311 Genomic DNA. No translation available.
AC117463 Genomic DNA. No translation available.
AK026702 mRNA. Translation: BAB15532.1. Different initiation.
AK093296 mRNA. Translation: BAG52683.1.
CCDSiCCDS3199.2. [A8MT70-1]
CCDS56295.1. [A8MT70-3]
CCDS56296.1. [A8MT70-2]
RefSeqiNP_078963.2. NM_024687.3. [A8MT70-1]
XP_016862678.1. XM_017007189.1. [A8MT70-1]
UniGeneiHs.478143.

Genome annotation databases

EnsembliENST00000307529; ENSP00000305065; ENSG00000169064. [A8MT70-2]
ENST00000392764; ENSP00000376517; ENSG00000169064. [A8MT70-3]
ENST00000392766; ENSP00000376519; ENSG00000169064. [A8MT70-1]
ENST00000392767; ENSP00000376520; ENSG00000169064. [A8MT70-3]
ENST00000455345; ENSP00000390232; ENSG00000169064. [A8MT70-2]
GeneIDi79740.
KEGGihsa:79740.
UCSCiuc003fep.4. human. [A8MT70-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC107311 Genomic DNA. No translation available.
AC117463 Genomic DNA. No translation available.
AK026702 mRNA. Translation: BAB15532.1. Different initiation.
AK093296 mRNA. Translation: BAG52683.1.
CCDSiCCDS3199.2. [A8MT70-1]
CCDS56295.1. [A8MT70-3]
CCDS56296.1. [A8MT70-2]
RefSeqiNP_078963.2. NM_024687.3. [A8MT70-1]
XP_016862678.1. XM_017007189.1. [A8MT70-1]
UniGeneiHs.478143.

3D structure databases

ProteinModelPortaliA8MT70.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122853. 25 interactors.

PTM databases

iPTMnetiA8MT70.
PhosphoSitePlusiA8MT70.

Polymorphism and mutation databases

BioMutaiZBBX.

Proteomic databases

PaxDbiA8MT70.
PRIDEiA8MT70.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307529; ENSP00000305065; ENSG00000169064. [A8MT70-2]
ENST00000392764; ENSP00000376517; ENSG00000169064. [A8MT70-3]
ENST00000392766; ENSP00000376519; ENSG00000169064. [A8MT70-1]
ENST00000392767; ENSP00000376520; ENSG00000169064. [A8MT70-3]
ENST00000455345; ENSP00000390232; ENSG00000169064. [A8MT70-2]
GeneIDi79740.
KEGGihsa:79740.
UCSCiuc003fep.4. human. [A8MT70-1]

Organism-specific databases

CTDi79740.
DisGeNETi79740.
GeneCardsiZBBX.
HGNCiHGNC:26245. ZBBX.
HPAiHPA036327.
HPA036328.
neXtProtiNX_A8MT70.
OpenTargetsiENSG00000169064.
PharmGKBiPA162409400.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVIG. Eukaryota.
ENOG4111KT9. LUCA.
GeneTreeiENSGT00390000018298.
HOGENOMiHOG000136319.
HOVERGENiHBG106618.
InParanoidiA8MT70.
OMAiHRRTPQE.
OrthoDBiEOG091G0RPO.
PhylomeDBiA8MT70.
TreeFamiTF337517.

Miscellaneous databases

GenomeRNAii79740.
PROiA8MT70.

Gene expression databases

BgeeiENSG00000169064.
CleanExiHS_ZBBX.
ExpressionAtlasiA8MT70. baseline and differential.
GenevisibleiA8MT70. HS.

Family and domain databases

InterProiIPR000315. Znf_B-box.
[Graphical view]
PfamiPF00643. zf-B_box. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZBBX_HUMAN
AccessioniPrimary (citable) accession number: A8MT70
Secondary accession number(s): A8MV69
, B3KSC1, B5MDJ6, F2Z370, Q9H5T8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 14, 2008
Last modified: November 2, 2016
This is version 76 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.