Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ERI1 exoribonuclease 2

Gene

ERI2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Cofactori

Mg2+By similarityNote: Binds 2 magnesium ions per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi41 – 411Magnesium 1By similarity
Metal bindingi41 – 411Magnesium 2By similarity
Active sitei43 – 431Proton acceptorSequence analysis
Metal bindingi43 – 431Magnesium 1By similarity
Binding sitei43 – 431AMPBy similarity
Metal bindingi156 – 1561Magnesium 2By similarity
Active sitei213 – 2131Proton acceptorSequence analysis
Binding sitei213 – 2131AMPBy similarity
Metal bindingi218 – 2181Magnesium 1By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Exonuclease, Hydrolase, Nuclease

Keywords - Ligandi

Magnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
ERI1 exoribonuclease 2 (EC:3.1.-.-)
Alternative name(s):
Exonuclease domain-containing protein 1
Gene namesi
Name:ERI2
Synonyms:EXOD1, KIAA1504
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:30541. ERI2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164719245.

Polymorphism and mutation databases

BioMutaiERI2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 691691ERI1 exoribonuclease 2PRO_0000338973Add
BLAST

Proteomic databases

EPDiA8K979.
MaxQBiA8K979.
PaxDbiA8K979.
PRIDEiA8K979.

PTM databases

iPTMnetiA8K979.
PhosphoSiteiA8K979.

Expressioni

Gene expression databases

BgeeiENSG00000196678.
CleanExiHS_ERI2.
ExpressionAtlasiA8K979. baseline and differential.
GenevisibleiA8K979. HS.

Organism-specific databases

HPAiHPA035384.
HPA035385.

Interactioni

Protein-protein interaction databases

BioGridi125189. 2 interactions.
IntActiA8K979. 1 interaction.
MINTiMINT-6782974.
STRINGi9606.ENSP00000350651.

Structurei

3D structure databases

ProteinModelPortaliA8K979.
SMRiA8K979. Positions 32-239.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini37 – 226190ExonucleaseAdd
BLAST

Sequence similaritiesi

Belongs to the ERI2 family.Curated
Contains 1 exonuclease domain.Curated

Phylogenomic databases

eggNOGiKOG0542. Eukaryota.
COG5018. LUCA.
GeneTreeiENSGT00530000063205.
HOGENOMiHOG000112417.
HOVERGENiHBG097018.
InParanoidiA8K979.
KOiK18417.
OMAiFPLENAH.
OrthoDBiEOG091G0KQM.
PhylomeDBiA8K979.
TreeFamiTF313449.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR013520. Exonuclease_RNaseT/DNA_pol3.
IPR012337. RNaseH-like_dom.
IPR010666. Znf_GRF.
[Graphical view]
PfamiPF00929. RNase_T. 1 hit.
PF06839. zf-GRF. 1 hit.
[Graphical view]
SMARTiSM00479. EXOIII. 1 hit.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A8K979-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATKRLARQL GLIRRKSIAP ANGNLGRSKS KQLFDYLIVI DFESTCWNDG
60 70 80 90 100
KHHHSQEIIE FPAVLLNTST GQIDSEFQAY VQPQEHPILS EFCMELTGIK
110 120 130 140 150
QAQVDEGVPL KICLSQFCKW IHKIQQQKNI IFATGISEPS ASEVKLCAFV
160 170 180 190 200
TWSDWDLGVC LEYECKRKQL LKPVFLNSWI DLRATYKLFY RRKPKGLSGA
210 220 230 240 250
LQEVGIEFSG REHSGLDDSR NTALLAWKMI RDGCVMKITR SLNKVPTKKN
260 270 280 290 300
FSILARNLNT IQVEEMSACN ISIQGPSIYN KEPKNIINPH EKVQMKSICA
310 320 330 340 350
NSPIKAQQDQ LQVKNNIKAS LHNVKSSLPL FNTKSSTSVG QLQSPTLNSP
360 370 380 390 400
IYMQKQGKNE HLAFNTKSKA STVGSELVLV STTVPTVHHV SDLEMSSTLD
410 420 430 440 450
CLPVLADWED VVLLPASQPE ENVDCTVPIS DSDLEISFNS GERLMVLKEL
460 470 480 490 500
EMSSHENFGD IEETPQKSET SKSIVYKSPH TTIYNVKEAK DPGSDISAFK
510 520 530 540 550
LPEHKSSTFN RVNANMSHPL VLGKHPLLSG GTKRNPCSPQ AFPPAKKQPF
560 570 580 590 600
TIHEEKPTSS DCSPVRSSSW RRLPSILTST VNLQEPWKSG KMTPPLCKCG
610 620 630 640 650
RRSKRLVVSN NGPNHGKVFY CCPIGKYQEN RKCCGYFKWE QTLQKERANS
660 670 680 690
MVPSHSTGGL TFSSPETSHI CDRNLSISTK NSLRLRPSMR N
Length:691
Mass (Da):77,401
Last modified:June 10, 2008 - v2
Checksum:i3A0DA36ABDDAA36D
GO
Isoform 2 (identifier: A8K979-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.

Show »
Length:598
Mass (Da):66,834
Checksum:i5A98B6E5DAF500EF
GO
Isoform 3 (identifier: A8K979-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-279: PTKKNFSILARNLNTIQVEEMSACNISIQGPSIY → VPKGIHAVPKLSHQQKNNPSLFMKKSLHHLIAPQ
     280-691: Missing.

Show »
Length:279
Mass (Da):31,756
Checksum:iE01128858643913C
GO
Isoform 4 (identifier: A8K979-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-328: VPTKKNFSIL...ASLHNVKSSL → GPFLLPSWTW...ASQTVTTEKF
     329-691: Missing.

Show »
Length:328
Mass (Da):37,479
Checksum:i5BF141A315A6EA1E
GO

Sequence cautioni

The sequence AAC31669 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti352 – 3521Y → C in BAA96028 (PubMed:10819331).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti206 – 2061I → T in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_043848
Isoform 4 (identifier: A8K979-4)
Natural varianti268 – 2681Q → K.
Corresponds to variant rs17850670 [ dbSNP | Ensembl ].
Natural varianti272 – 2721G → E.
Corresponds to variant rs2301770 [ dbSNP | Ensembl ].

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9393Missing in isoform 2. 1 PublicationVSP_034077Add
BLAST
Alternative sequencei245 – 32884VPTKK…VKSSL → GPFLLPSWTWNSDLASGDQH AFLQQEFGCGTYRTLLQKPN MSKQEKGNILWLTMVWLSLA CLQRKNYNDCMLNTASQTVT TEKF in isoform 4. 1 PublicationVSP_034078Add
BLAST
Alternative sequencei246 – 27934PTKKN…GPSIY → VPKGIHAVPKLSHQQKNNPS LFMKKSLHHLIAPQ in isoform 3. 1 PublicationVSP_034079Add
BLAST
Alternative sequencei280 – 691412Missing in isoform 3. 1 PublicationVSP_034080Add
BLAST
Alternative sequencei329 – 691363Missing in isoform 4. 1 PublicationVSP_034081Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127391 mRNA. Translation: BAC86956.1.
AK292594 mRNA. Translation: BAF85283.1.
AC004381 Genomic DNA. Translation: AAC31669.1. Sequence problems.
BC010503 mRNA. Translation: AAH10503.1.
AB040937 mRNA. Translation: BAA96028.1.
CCDSiCCDS10590.1. [A8K979-4]
CCDS45436.1. [A8K979-1]
RefSeqiNP_001136197.1. NM_001142725.1. [A8K979-1]
NP_542394.2. NM_080663.2. [A8K979-4]
UniGeneiHs.248437.

Genome annotation databases

EnsembliENST00000300005; ENSP00000300005; ENSG00000196678. [A8K979-4]
ENST00000357967; ENSP00000350651; ENSG00000196678. [A8K979-1]
ENST00000563117; ENSP00000454661; ENSG00000196678. [A8K979-2]
ENST00000564349; ENSP00000455982; ENSG00000196678. [A8K979-2]
ENST00000569729; ENSP00000457488; ENSG00000196678. [A8K979-3]
GeneIDi112479.
KEGGihsa:112479.
UCSCiuc002dhs.3. human. [A8K979-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127391 mRNA. Translation: BAC86956.1.
AK292594 mRNA. Translation: BAF85283.1.
AC004381 Genomic DNA. Translation: AAC31669.1. Sequence problems.
BC010503 mRNA. Translation: AAH10503.1.
AB040937 mRNA. Translation: BAA96028.1.
CCDSiCCDS10590.1. [A8K979-4]
CCDS45436.1. [A8K979-1]
RefSeqiNP_001136197.1. NM_001142725.1. [A8K979-1]
NP_542394.2. NM_080663.2. [A8K979-4]
UniGeneiHs.248437.

3D structure databases

ProteinModelPortaliA8K979.
SMRiA8K979. Positions 32-239.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125189. 2 interactions.
IntActiA8K979. 1 interaction.
MINTiMINT-6782974.
STRINGi9606.ENSP00000350651.

PTM databases

iPTMnetiA8K979.
PhosphoSiteiA8K979.

Polymorphism and mutation databases

BioMutaiERI2.

Proteomic databases

EPDiA8K979.
MaxQBiA8K979.
PaxDbiA8K979.
PRIDEiA8K979.

Protocols and materials databases

DNASUi112479.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300005; ENSP00000300005; ENSG00000196678. [A8K979-4]
ENST00000357967; ENSP00000350651; ENSG00000196678. [A8K979-1]
ENST00000563117; ENSP00000454661; ENSG00000196678. [A8K979-2]
ENST00000564349; ENSP00000455982; ENSG00000196678. [A8K979-2]
ENST00000569729; ENSP00000457488; ENSG00000196678. [A8K979-3]
GeneIDi112479.
KEGGihsa:112479.
UCSCiuc002dhs.3. human. [A8K979-1]

Organism-specific databases

CTDi112479.
GeneCardsiERI2.
HGNCiHGNC:30541. ERI2.
HPAiHPA035384.
HPA035385.
neXtProtiNX_A8K979.
PharmGKBiPA164719245.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0542. Eukaryota.
COG5018. LUCA.
GeneTreeiENSGT00530000063205.
HOGENOMiHOG000112417.
HOVERGENiHBG097018.
InParanoidiA8K979.
KOiK18417.
OMAiFPLENAH.
OrthoDBiEOG091G0KQM.
PhylomeDBiA8K979.
TreeFamiTF313449.

Miscellaneous databases

ChiTaRSiERI2. human.
GenomeRNAii112479.
PROiA8K979.

Gene expression databases

BgeeiENSG00000196678.
CleanExiHS_ERI2.
ExpressionAtlasiA8K979. baseline and differential.
GenevisibleiA8K979. HS.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR013520. Exonuclease_RNaseT/DNA_pol3.
IPR012337. RNaseH-like_dom.
IPR010666. Znf_GRF.
[Graphical view]
PfamiPF00929. RNase_T. 1 hit.
PF06839. zf-GRF. 1 hit.
[Graphical view]
SMARTiSM00479. EXOIII. 1 hit.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiERI2_HUMAN
AccessioniPrimary (citable) accession number: A8K979
Secondary accession number(s): Q6ZSJ2
, Q96FR9, Q9P224, Q9Y6V3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: September 7, 2016
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.