Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone-lysine N-methyltransferase EZH1

Gene

EZH1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation (By similarity).By similarity

Catalytic activityi

S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N6-methyl-L-lysine-[histone].

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator, Methyltransferase, Repressor, Transferase
Biological processTranscription, Transcription regulation
LigandS-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
Histone-lysine N-methyltransferase EZH1 (EC:2.1.1.43)
Alternative name(s):
Enhancer of zeste homolog 1
Gene namesi
Name:EZH1
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 19

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003639561 – 747Histone-lysine N-methyltransferase EZH1Add BLAST747

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki327Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

PaxDbiA7E2Z2.
PRIDEiA7E2Z2.

Expressioni

Gene expression databases

BgeeiENSBTAG00000021918.

Interactioni

Subunit structurei

Component of the PRC2/EED-EZH1 complex, which includes EED, EZH1, SUZ12, RBBP4 and AEBP2. The PRC2/EED-EZH1 is less abundant than the PRC2/EED-EZH2 complex, has weak methyltransferase activity and compacts chromatin in the absence of the methyltransferase cofactor S-adenosyl-L-methionine (SAM) (By similarity).By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000029222.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini504 – 606CXCPROSITE-ProRule annotationAdd BLAST103
Domaini613 – 728SETPROSITE-ProRule annotationAdd BLAST116

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi524 – 605Cys-richAdd BLAST82

Sequence similaritiesi

Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1079. Eukaryota.
COG2940. LUCA.
GeneTreeiENSGT00760000119228.
HOGENOMiHOG000008176.
HOVERGENiHBG002453.
InParanoidiA7E2Z2.
KOiK17451.
OMAiQVYNYQP.
OrthoDBiEOG091G09L0.
TreeFamiTF314509.

Family and domain databases

CDDicd00167. SANT. 1 hit.
InterProiView protein in InterPro
IPR026489. CXC_dom.
IPR032926. EZH1.
IPR021654. EZH1/EZH2.
IPR001005. SANT/Myb.
IPR001214. SET_dom.
IPR033467. Tesmin/TSO1-like_CXC.
PANTHERiPTHR22884:SF333. PTHR22884:SF333. 1 hit.
PfamiView protein in Pfam
PF11616. EZH2_WD-Binding. 1 hit.
PF00856. SET. 1 hit.
SMARTiView protein in SMART
SM01114. CXC. 1 hit.
SM00717. SANT. 2 hits.
SM00317. SET. 1 hit.
PROSITEiView protein in PROSITE
PS51633. CXC. 1 hit.
PS50280. SET. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A7E2Z2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDIPNPPTSK CITYWKRKVK SEYMRLRQLK RLQANMGAKA LYVANFAKVQ
60 70 80 90 100
EKTQILNEEW KKLRVQPVQL MKPVSGHPFL KKCTIESIFP GFASQHMLMR
110 120 130 140 150
SLNTVALVPI MYSWSPLQQN FMVEDETVLC NIPYMGDEVK EEDETFIEEL
160 170 180 190 200
INNYDGKVHG EEEMIPGSVL ISDAVFLELV DALNQYSDED EEGHNDTSDG
210 220 230 240 250
KQDDSKEDLP VTRKRKRHAI EGSKKSSKKQ FPNDMIFSAI ASMFPENGVP
260 270 280 290 300
DDMKERYREL TEMSDPNALP PQCTPNIDGP NAKSVQREQS LHSFHTLFCR
310 320 330 340 350
RCFKYDCFLH PFHATPNVYK RKNKEIKIEP EPCGTDCFLL LEGAKEYAML
360 370 380 390 400
HNPRSKCSGR RRRRHHVVNA SCSNTSASAV AETKEGDSDR DTGNDWASSS
410 420 430 440 450
SEANSRCQTP TKQKASPAPP QLCVVEAPSE PVEWTGAEES LFRVFHGTYF
460 470 480 490 500
NNFCSIARLL GTKTCKQVFQ FAVKESLILK LPTDELMNPS QKKKRKHRLW
510 520 530 540 550
AAHCRKIQLK KDNSSTQVYN YQPCDHPDRP CDSTCPCIMT QNFCEKFCQC
560 570 580 590 600
NPDCQNRFPG CRCKTQCNTK QCPCYLAVRE CDPDLCLTCG ASEHWDCKVV
610 620 630 640 650
SCKNCSIQRG LKKHLLLAPS DVAGWGTFIK ESVQKNEFIS EYCGELISQD
660 670 680 690 700
EADRRGKVYD KYMSSFLFNL NNDFVVDATR KGNKIRFANH SVNPNCYAKV
710 720 730 740
VMVNGDHRIG IFAKRAIQAG EELFFDYRYS QADALKYVGI ERETDVL
Length:747
Mass (Da):85,285
Last modified:February 10, 2009 - v2
Checksum:iA40D3D08F63CA155
GO
Isoform 2 (identifier: A7E2Z2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     700-747: VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL → AKITDLKA

Note: No experimental confirmation available.
Show »
Length:707
Mass (Da):80,639
Checksum:i3A925BD51154C096
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036369700 – 747VVMVN…ETDVL → AKITDLKA in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC151626 mRNA. Translation: AAI51627.1.
RefSeqiNP_001095621.1. NM_001102151.2. [A7E2Z2-2]
XP_005220793.1. XM_005220736.3. [A7E2Z2-1]
XP_015314321.1. XM_015458835.1. [A7E2Z2-1]
UniGeneiBt.21818.

Genome annotation databases

EnsembliENSBTAT00000029222; ENSBTAP00000029222; ENSBTAG00000021918. [A7E2Z2-2]
GeneIDi533087.
KEGGibta:533087.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiEZH1_BOVIN
AccessioniPrimary (citable) accession number: A7E2Z2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: February 10, 2009
Last modified: October 25, 2017
This is version 78 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families