Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A7E2Z2

- EZH1_BOVIN

UniProt

A7E2Z2 - EZH1_BOVIN

Protein

Histone-lysine N-methyltransferase EZH1

Gene

EZH1

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 56 (01 Oct 2014)
      Sequence version 2 (10 Feb 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation By similarity.By similarity

    Catalytic activityi

    S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].

    GO - Molecular functioni

    1. chromatin binding Source: InterPro
    2. histone methyltransferase activity (H3-K27 specific) Source: Ensembl

    GO - Biological processi

    1. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chromatin regulator, Methyltransferase, Repressor, Transferase

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    S-adenosyl-L-methionine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Histone-lysine N-methyltransferase EZH1 (EC:2.1.1.43)
    Alternative name(s):
    Enhancer of zeste homolog 1
    Gene namesi
    Name:EZH1
    OrganismiBos taurus (Bovine)
    Taxonomic identifieri9913 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
    ProteomesiUP000009136: Chromosome 19

    Subcellular locationi

    Nucleus By similarity
    Note: Colocalizes with trimethylated 'Lys-27' of histone H3.By similarity

    GO - Cellular componenti

    1. ESC/E(Z) complex Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 747747Histone-lysine N-methyltransferase EZH1PRO_0000363956Add
    BLAST

    Interactioni

    Subunit structurei

    Component of the PRC2/EED-EZH1 complex, which includes EED, EZH1, SUZ12, RBBP4 and AEBP2. The PRC2/EED-EZH1 is less abundant than the PRC2/EED-EZH2 complex, has weak methyltransferase activity and compacts chromatin in the absence of the methyltransferase cofactor S-adenosyl-L-methionine (SAM) By similarity.By similarity

    Protein-protein interaction databases

    STRINGi9913.ENSBTAP00000029222.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini504 – 606103CXCPROSITE-ProRule annotationAdd
    BLAST
    Domaini613 – 728116SETPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi524 – 60582Cys-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.PROSITE-ProRule annotation
    Contains 1 CXC domain.PROSITE-ProRule annotation
    Contains 1 SET domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG2940.
    GeneTreeiENSGT00740000115009.
    HOGENOMiHOG000008176.
    HOVERGENiHBG002453.
    InParanoidiA7E2Z2.
    KOiK17451.
    OMAiSTQVYNY.
    OrthoDBiEOG7VB2DR.
    TreeFamiTF314509.

    Family and domain databases

    InterProiIPR026489. CXC_dom.
    IPR021654. EZH2_WD-Binding.
    IPR001005. SANT/Myb.
    IPR001214. SET_dom.
    [Graphical view]
    PfamiPF11616. EZH2_WD-Binding. 1 hit.
    PF00856. SET. 1 hit.
    [Graphical view]
    SMARTiSM00717. SANT. 2 hits.
    SM00317. SET. 1 hit.
    [Graphical view]
    PROSITEiPS51633. CXC. 1 hit.
    PS50280. SET. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A7E2Z2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDIPNPPTSK CITYWKRKVK SEYMRLRQLK RLQANMGAKA LYVANFAKVQ    50
    EKTQILNEEW KKLRVQPVQL MKPVSGHPFL KKCTIESIFP GFASQHMLMR 100
    SLNTVALVPI MYSWSPLQQN FMVEDETVLC NIPYMGDEVK EEDETFIEEL 150
    INNYDGKVHG EEEMIPGSVL ISDAVFLELV DALNQYSDED EEGHNDTSDG 200
    KQDDSKEDLP VTRKRKRHAI EGSKKSSKKQ FPNDMIFSAI ASMFPENGVP 250
    DDMKERYREL TEMSDPNALP PQCTPNIDGP NAKSVQREQS LHSFHTLFCR 300
    RCFKYDCFLH PFHATPNVYK RKNKEIKIEP EPCGTDCFLL LEGAKEYAML 350
    HNPRSKCSGR RRRRHHVVNA SCSNTSASAV AETKEGDSDR DTGNDWASSS 400
    SEANSRCQTP TKQKASPAPP QLCVVEAPSE PVEWTGAEES LFRVFHGTYF 450
    NNFCSIARLL GTKTCKQVFQ FAVKESLILK LPTDELMNPS QKKKRKHRLW 500
    AAHCRKIQLK KDNSSTQVYN YQPCDHPDRP CDSTCPCIMT QNFCEKFCQC 550
    NPDCQNRFPG CRCKTQCNTK QCPCYLAVRE CDPDLCLTCG ASEHWDCKVV 600
    SCKNCSIQRG LKKHLLLAPS DVAGWGTFIK ESVQKNEFIS EYCGELISQD 650
    EADRRGKVYD KYMSSFLFNL NNDFVVDATR KGNKIRFANH SVNPNCYAKV 700
    VMVNGDHRIG IFAKRAIQAG EELFFDYRYS QADALKYVGI ERETDVL 747
    Length:747
    Mass (Da):85,285
    Last modified:February 10, 2009 - v2
    Checksum:iA40D3D08F63CA155
    GO
    Isoform 2 (identifier: A7E2Z2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         700-747: VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL → AKITDLKA

    Note: No experimental confirmation available.

    Show »
    Length:707
    Mass (Da):80,639
    Checksum:i3A925BD51154C096
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei700 – 74748VVMVN…ETDVL → AKITDLKA in isoform 2. 1 PublicationVSP_036369Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC151626 mRNA. Translation: AAI51627.1.
    RefSeqiNP_001095621.1. NM_001102151.2. [A7E2Z2-2]
    XP_005220793.1. XM_005220736.1. [A7E2Z2-1]
    UniGeneiBt.21818.

    Genome annotation databases

    EnsembliENSBTAT00000029222; ENSBTAP00000029222; ENSBTAG00000021918. [A7E2Z2-2]
    GeneIDi533087.
    KEGGibta:533087.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC151626 mRNA. Translation: AAI51627.1 .
    RefSeqi NP_001095621.1. NM_001102151.2. [A7E2Z2-2 ]
    XP_005220793.1. XM_005220736.1. [A7E2Z2-1 ]
    UniGenei Bt.21818.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9913.ENSBTAP00000029222.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSBTAT00000029222 ; ENSBTAP00000029222 ; ENSBTAG00000021918 . [A7E2Z2-2 ]
    GeneIDi 533087.
    KEGGi bta:533087.

    Organism-specific databases

    CTDi 2145.

    Phylogenomic databases

    eggNOGi COG2940.
    GeneTreei ENSGT00740000115009.
    HOGENOMi HOG000008176.
    HOVERGENi HBG002453.
    InParanoidi A7E2Z2.
    KOi K17451.
    OMAi STQVYNY.
    OrthoDBi EOG7VB2DR.
    TreeFami TF314509.

    Miscellaneous databases

    NextBioi 20875906.

    Family and domain databases

    InterProi IPR026489. CXC_dom.
    IPR021654. EZH2_WD-Binding.
    IPR001005. SANT/Myb.
    IPR001214. SET_dom.
    [Graphical view ]
    Pfami PF11616. EZH2_WD-Binding. 1 hit.
    PF00856. SET. 1 hit.
    [Graphical view ]
    SMARTi SM00717. SANT. 2 hits.
    SM00317. SET. 1 hit.
    [Graphical view ]
    PROSITEi PS51633. CXC. 1 hit.
    PS50280. SET. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. NIH - Mammalian Gene Collection (MGC) project
      Submitted (AUG-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: Hereford.
      Tissue: Thymus.

    Entry informationi

    Entry nameiEZH1_BOVIN
    AccessioniPrimary (citable) accession number: A7E2Z2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 10, 2009
    Last sequence update: February 10, 2009
    Last modified: October 1, 2014
    This is version 56 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3