A7E2Z2 (EZH1_BOVIN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 46.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase EZH1 EC=2.1.1.43 Alternative name(s): Enhancer of zeste homolog 1 | ||
| Gene names |
| ||
| Organism | Bos taurus (Bovine) [Reference proteome] | ||
| Taxonomic identifier | 9913 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos |
Protein attributes
| Sequence length | 747 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH1-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation By similarity. |
| Catalytic activity | S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone]. |
| Subunit structure | Component of the PRC2/EED-EZH1 complex, which includes EED, EZH1, SUZ12, RBBP4 and AEBP2. The PRC2/EED-EZH1 is less abundant than the PRC2/EED-EZH2 complex, has weak methyltransferase activity and compacts chromatin in the absence of the methyltransferase cofactor S-adenosyl-L-methionine (SAM) By similarity. |
| Subcellular location | Nucleus By similarity. Note: Colocalizes with trimethylated 'Lys-27' of histone H3 By similarity. |
| Sequence similarities | Belongs to the histone-lysine methyltransferase family. EZ subfamily. Contains 1 CXC domain. Contains 1 SET domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | S-adenosyl-L-methionine |
| Molecular function | Chromatin regulator Methyltransferase Repressor Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of transcription from RNA polymerase II promoter Inferred from electronic annotation. Source: Compara transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | ESC/E(Z) complex Inferred from sequence or structural similarity. Source: UniProtKB |
| Molecular_function | chromatin binding Inferred from electronic annotation. Source: InterPro histone methyltransferase activity (H3-K27 specific)Inferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A7E2Z2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A7E2Z2-2) The sequence of this isoform differs from the canonical sequence as follows: 700-747: VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL → AKITDLKA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 747 | 747 | Histone-lysine N-methyltransferase EZH1 | PRO_0000363956 | |||||
Regions | |||||||||
| Domain | 504 – 606 | 103 | CXC | ||||||
| Domain | 612 – 732 | 121 | SET | ||||||
| Compositional bias | 524 – 605 | 82 | Cys-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 700 – 747 | 48 | VVMVN…ETDVL → AKITDLKA in isoform 2. | VSP_036369 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | NIH - Mammalian Gene Collection (MGC) project Submitted (AUG-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: Hereford. Tissue: Thymus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC151626 mRNA. Translation: AAI51627.1. |
| IPI | IPI00867353. IPI00921785. |
| RefSeq | NP_001095621.1. NM_001102151.2. |
| UniGene | Bt.21818. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9913.ENSBTAP00000029222. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSBTAT00000029222; ENSBTAP00000029222; ENSBTAG00000021918. |
| GeneID | 533087. |
| KEGG | bta:533087. |
Organism-specific databases | |
| CTD | 2145. |
Phylogenomic databases | |
| eggNOG | COG2940. |
| GeneTree | ENSGT00700000104213. |
| HOGENOM | HOG000008176. |
| HOVERGEN | HBG002453. |
| InParanoid | A7E2Z2. |
| KO | K11430. |
| OMA | IRVETEP. |
| OrthoDB | EOG4CJVGK. |
Family and domain databases | |
| InterPro | IPR026489. CXC_dom. IPR021654. EZH2_WD-Binding. IPR001005. SANT/Myb. IPR001214. SET_dom. [Graphical view] |
| Pfam | PF11616. EZH2_WD-Binding. 1 hit. PF00856. SET. 1 hit. [Graphical view] |
| SMART | SM00717. SANT. 2 hits. SM00317. SET. 1 hit. [Graphical view] |
| PROSITE | PS51633. CXC. 1 hit. PS50280. SET. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20875906. |
Entry information
| Entry name | EZH1_BOVIN | ||||||||
| Accession | Primary (citable) accession number: A7E2Z2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |