Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A7E2Z2 (EZH1_BOVIN) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 55. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Histone-lysine N-methyltransferase EZH1

EC=2.1.1.43
Alternative name(s):
Enhancer of zeste homolog 1
Gene names
Name:EZH1
OrganismBos taurus (Bovine) [Reference proteome]
Taxonomic identifier9913 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos

Protein attributes

Sequence length747 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation By similarity.

Catalytic activity

S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].

Subunit structure

Component of the PRC2/EED-EZH1 complex, which includes EED, EZH1, SUZ12, RBBP4 and AEBP2. The PRC2/EED-EZH1 is less abundant than the PRC2/EED-EZH2 complex, has weak methyltransferase activity and compacts chromatin in the absence of the methyltransferase cofactor S-adenosyl-L-methionine (SAM) By similarity.

Subcellular location

Nucleus By similarity. Note: Colocalizes with trimethylated 'Lys-27' of histone H3 By similarity.

Sequence similarities

Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.

Contains 1 CXC domain.

Contains 1 SET domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A7E2Z2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A7E2Z2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     700-747: VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL → AKITDLKA
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 747747Histone-lysine N-methyltransferase EZH1
PRO_0000363956

Regions

Domain504 – 606103CXC
Domain613 – 728116SET
Compositional bias524 – 60582Cys-rich

Natural variations

Alternative sequence700 – 74748VVMVN…ETDVL → AKITDLKA in isoform 2.
VSP_036369

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 10, 2009. Version 2.
Checksum: A40D3D08F63CA155

FASTA74785,285
        10         20         30         40         50         60 
MDIPNPPTSK CITYWKRKVK SEYMRLRQLK RLQANMGAKA LYVANFAKVQ EKTQILNEEW 

        70         80         90        100        110        120 
KKLRVQPVQL MKPVSGHPFL KKCTIESIFP GFASQHMLMR SLNTVALVPI MYSWSPLQQN 

       130        140        150        160        170        180 
FMVEDETVLC NIPYMGDEVK EEDETFIEEL INNYDGKVHG EEEMIPGSVL ISDAVFLELV 

       190        200        210        220        230        240 
DALNQYSDED EEGHNDTSDG KQDDSKEDLP VTRKRKRHAI EGSKKSSKKQ FPNDMIFSAI 

       250        260        270        280        290        300 
ASMFPENGVP DDMKERYREL TEMSDPNALP PQCTPNIDGP NAKSVQREQS LHSFHTLFCR 

       310        320        330        340        350        360 
RCFKYDCFLH PFHATPNVYK RKNKEIKIEP EPCGTDCFLL LEGAKEYAML HNPRSKCSGR 

       370        380        390        400        410        420 
RRRRHHVVNA SCSNTSASAV AETKEGDSDR DTGNDWASSS SEANSRCQTP TKQKASPAPP 

       430        440        450        460        470        480 
QLCVVEAPSE PVEWTGAEES LFRVFHGTYF NNFCSIARLL GTKTCKQVFQ FAVKESLILK 

       490        500        510        520        530        540 
LPTDELMNPS QKKKRKHRLW AAHCRKIQLK KDNSSTQVYN YQPCDHPDRP CDSTCPCIMT 

       550        560        570        580        590        600 
QNFCEKFCQC NPDCQNRFPG CRCKTQCNTK QCPCYLAVRE CDPDLCLTCG ASEHWDCKVV 

       610        620        630        640        650        660 
SCKNCSIQRG LKKHLLLAPS DVAGWGTFIK ESVQKNEFIS EYCGELISQD EADRRGKVYD 

       670        680        690        700        710        720 
KYMSSFLFNL NNDFVVDATR KGNKIRFANH SVNPNCYAKV VMVNGDHRIG IFAKRAIQAG 

       730        740 
EELFFDYRYS QADALKYVGI ERETDVL 

« Hide

Isoform 2 [UniParc].

Checksum: 3A925BD51154C096
Show »

FASTA70780,639

References

[1]NIH - Mammalian Gene Collection (MGC) project
Submitted (AUG-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: Hereford.
Tissue: Thymus.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BC151626 mRNA. Translation: AAI51627.1.
RefSeqNP_001095621.1. NM_001102151.2. [A7E2Z2-2]
XP_005220793.1. XM_005220736.1. [A7E2Z2-1]
UniGeneBt.21818.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9913.ENSBTAP00000029222.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSBTAT00000029222; ENSBTAP00000029222; ENSBTAG00000021918. [A7E2Z2-2]
GeneID533087.
KEGGbta:533087.

Organism-specific databases

CTD2145.

Phylogenomic databases

eggNOGCOG2940.
GeneTreeENSGT00740000115009.
HOGENOMHOG000008176.
HOVERGENHBG002453.
InParanoidA7E2Z2.
KOK17451.
OMASTQVYNY.
OrthoDBEOG7VB2DR.
TreeFamTF314509.

Family and domain databases

InterProIPR026489. CXC_dom.
IPR021654. EZH2_WD-Binding.
IPR001005. SANT/Myb.
IPR001214. SET_dom.
[Graphical view]
PfamPF11616. EZH2_WD-Binding. 1 hit.
PF00856. SET. 1 hit.
[Graphical view]
SMARTSM00717. SANT. 2 hits.
SM00317. SET. 1 hit.
[Graphical view]
PROSITEPS51633. CXC. 1 hit.
PS50280. SET. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20875906.

Entry information

Entry nameEZH1_BOVIN
AccessionPrimary (citable) accession number: A7E2Z2
Entry history
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: February 10, 2009
Last modified: May 14, 2014
This is version 55 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families