Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone-lysine N-methyltransferase EZH1

Gene

EZH1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation (By similarity).By similarity

Catalytic activityi

S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].

GO - Molecular functioni

  1. chromatin binding Source: InterPro
  2. histone methyltransferase activity (H3-K27 specific) Source: Ensembl

GO - Biological processi

  1. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Methyltransferase, Repressor, Transferase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
Histone-lysine N-methyltransferase EZH1 (EC:2.1.1.43)
Alternative name(s):
Enhancer of zeste homolog 1
Gene namesi
Name:EZH1
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
ProteomesiUP000009136: Chromosome 19

Subcellular locationi

Nucleus By similarity
Note: Colocalizes with trimethylated 'Lys-27' of histone H3.By similarity

GO - Cellular componenti

  1. ESC/E(Z) complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 747747Histone-lysine N-methyltransferase EZH1PRO_0000363956Add
BLAST

Interactioni

Subunit structurei

Component of the PRC2/EED-EZH1 complex, which includes EED, EZH1, SUZ12, RBBP4 and AEBP2. The PRC2/EED-EZH1 is less abundant than the PRC2/EED-EZH2 complex, has weak methyltransferase activity and compacts chromatin in the absence of the methyltransferase cofactor S-adenosyl-L-methionine (SAM) (By similarity).By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000029222.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini504 – 606103CXCPROSITE-ProRule annotationAdd
BLAST
Domaini613 – 728116SETPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi524 – 60582Cys-richAdd
BLAST

Sequence similaritiesi

Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.PROSITE-ProRule annotation
Contains 1 CXC domain.PROSITE-ProRule annotation
Contains 1 SET domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG2940.
GeneTreeiENSGT00760000119228.
HOGENOMiHOG000008176.
HOVERGENiHBG002453.
InParanoidiA7E2Z2.
KOiK17451.
OMAiSTQVYNY.
OrthoDBiEOG7VB2DR.
TreeFamiTF314509.

Family and domain databases

InterProiIPR026489. CXC_dom.
IPR021654. EZH2_WD-Binding.
IPR001005. SANT/Myb.
IPR001214. SET_dom.
[Graphical view]
PfamiPF11616. EZH2_WD-Binding. 1 hit.
PF00856. SET. 1 hit.
[Graphical view]
SMARTiSM00717. SANT. 2 hits.
SM00317. SET. 1 hit.
[Graphical view]
PROSITEiPS51633. CXC. 1 hit.
PS50280. SET. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A7E2Z2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDIPNPPTSK CITYWKRKVK SEYMRLRQLK RLQANMGAKA LYVANFAKVQ
60 70 80 90 100
EKTQILNEEW KKLRVQPVQL MKPVSGHPFL KKCTIESIFP GFASQHMLMR
110 120 130 140 150
SLNTVALVPI MYSWSPLQQN FMVEDETVLC NIPYMGDEVK EEDETFIEEL
160 170 180 190 200
INNYDGKVHG EEEMIPGSVL ISDAVFLELV DALNQYSDED EEGHNDTSDG
210 220 230 240 250
KQDDSKEDLP VTRKRKRHAI EGSKKSSKKQ FPNDMIFSAI ASMFPENGVP
260 270 280 290 300
DDMKERYREL TEMSDPNALP PQCTPNIDGP NAKSVQREQS LHSFHTLFCR
310 320 330 340 350
RCFKYDCFLH PFHATPNVYK RKNKEIKIEP EPCGTDCFLL LEGAKEYAML
360 370 380 390 400
HNPRSKCSGR RRRRHHVVNA SCSNTSASAV AETKEGDSDR DTGNDWASSS
410 420 430 440 450
SEANSRCQTP TKQKASPAPP QLCVVEAPSE PVEWTGAEES LFRVFHGTYF
460 470 480 490 500
NNFCSIARLL GTKTCKQVFQ FAVKESLILK LPTDELMNPS QKKKRKHRLW
510 520 530 540 550
AAHCRKIQLK KDNSSTQVYN YQPCDHPDRP CDSTCPCIMT QNFCEKFCQC
560 570 580 590 600
NPDCQNRFPG CRCKTQCNTK QCPCYLAVRE CDPDLCLTCG ASEHWDCKVV
610 620 630 640 650
SCKNCSIQRG LKKHLLLAPS DVAGWGTFIK ESVQKNEFIS EYCGELISQD
660 670 680 690 700
EADRRGKVYD KYMSSFLFNL NNDFVVDATR KGNKIRFANH SVNPNCYAKV
710 720 730 740
VMVNGDHRIG IFAKRAIQAG EELFFDYRYS QADALKYVGI ERETDVL
Length:747
Mass (Da):85,285
Last modified:February 10, 2009 - v2
Checksum:iA40D3D08F63CA155
GO
Isoform 2 (identifier: A7E2Z2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     700-747: VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL → AKITDLKA

Note: No experimental confirmation available.

Show »
Length:707
Mass (Da):80,639
Checksum:i3A925BD51154C096
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei700 – 74748VVMVN…ETDVL → AKITDLKA in isoform 2. 1 PublicationVSP_036369Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC151626 mRNA. Translation: AAI51627.1.
RefSeqiNP_001095621.1. NM_001102151.2. [A7E2Z2-2]
XP_005220793.1. XM_005220736.1. [A7E2Z2-1]
UniGeneiBt.21818.

Genome annotation databases

EnsembliENSBTAT00000029222; ENSBTAP00000029222; ENSBTAG00000021918. [A7E2Z2-2]
GeneIDi533087.
KEGGibta:533087.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC151626 mRNA. Translation: AAI51627.1.
RefSeqiNP_001095621.1. NM_001102151.2. [A7E2Z2-2]
XP_005220793.1. XM_005220736.1. [A7E2Z2-1]
UniGeneiBt.21818.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000029222.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000029222; ENSBTAP00000029222; ENSBTAG00000021918. [A7E2Z2-2]
GeneIDi533087.
KEGGibta:533087.

Organism-specific databases

CTDi2145.

Phylogenomic databases

eggNOGiCOG2940.
GeneTreeiENSGT00760000119228.
HOGENOMiHOG000008176.
HOVERGENiHBG002453.
InParanoidiA7E2Z2.
KOiK17451.
OMAiSTQVYNY.
OrthoDBiEOG7VB2DR.
TreeFamiTF314509.

Miscellaneous databases

NextBioi20875906.

Family and domain databases

InterProiIPR026489. CXC_dom.
IPR021654. EZH2_WD-Binding.
IPR001005. SANT/Myb.
IPR001214. SET_dom.
[Graphical view]
PfamiPF11616. EZH2_WD-Binding. 1 hit.
PF00856. SET. 1 hit.
[Graphical view]
SMARTiSM00717. SANT. 2 hits.
SM00317. SET. 1 hit.
[Graphical view]
PROSITEiPS51633. CXC. 1 hit.
PS50280. SET. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. NIH - Mammalian Gene Collection (MGC) project
    Submitted (AUG-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: Hereford.
    Tissue: Thymus.

Entry informationi

Entry nameiEZH1_BOVIN
AccessioniPrimary (citable) accession number: A7E2Z2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: February 10, 2009
Last modified: February 4, 2015
This is version 59 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.