Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and BTB/POZ domain-containing protein BTBD11

Gene

BTBD11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
Alternative name(s):
BTB/POZ domain-containing protein 11
Gene namesi
Name:BTBD11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:23844. BTBD11.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei168 – 18821HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134975180.

Polymorphism and mutation databases

BioMutaiBTBD11.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11041104Ankyrin repeat and BTB/POZ domain-containing protein BTBD11PRO_0000328827Add
BLAST

Proteomic databases

EPDiA6QL63.
MaxQBiA6QL63.
PaxDbiA6QL63.
PeptideAtlasiA6QL63.
PRIDEiA6QL63.

PTM databases

iPTMnetiA6QL63.
PhosphoSiteiA6QL63.

Expressioni

Inductioni

By all-trans retinoic acid (ATRA).

Gene expression databases

BgeeiA6QL63.
CleanExiHS_BTBD11.
ExpressionAtlasiA6QL63. baseline and differential.
GenevisibleiA6QL63. HS.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi125738. 1 interaction.
IntActiA6QL63. 1 interaction.
STRINGi9606.ENSP00000280758.

Structurei

3D structure databases

ProteinModelPortaliA6QL63.
SMRiA6QL63. Positions 123-248, 571-751, 919-1087.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati603 – 63230ANK 1Add
BLAST
Repeati649 – 67830ANK 2Add
BLAST
Repeati687 – 71630ANK 3Add
BLAST
Repeati730 – 75930ANK 4Add
BLAST
Repeati825 – 85430ANK 5Add
BLAST
Domaini923 – 98967BTBPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi280 – 33051Ala-richAdd
BLAST
Compositional biasi332 – 34110His-rich

Sequence similaritiesi

Contains 5 ANK repeats.PROSITE-ProRule annotation
Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IESM. Eukaryota.
ENOG410XRDX. LUCA.
GeneTreeiENSGT00550000074669.
HOGENOMiHOG000033776.
HOVERGENiHBG050447.
InParanoidiA6QL63.
KOiK10483.
OMAiSINTENC.
OrthoDBiEOG773XF8.
PhylomeDBiA6QL63.
TreeFamiTF106437.

Family and domain databases

Gene3Di1.10.20.10. 3 hits.
1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR000210. BTB/POZ_dom.
IPR009072. Histone-fold.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 1 hit.
PF00651. BTB. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 4 hits.
SM00225. BTB. 1 hit.
[Graphical view]
SUPFAMiSSF47113. SSF47113. 3 hits.
SSF48403. SSF48403. 1 hit.
SSF54695. SSF54695. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
PS50097. BTB. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6QL63-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARRGKKPVV RTLEDLTLDS GYGGAADSVR SSNLSLCCSD SHPASPYGGS
60 70 80 90 100
CWPPLADSMH SRHNSFDTVN TALVEDSEGL DCAGQHCSRL LPDLDEVPWT
110 120 130 140 150
LQELEALLLR SRDPRAGPAV PGGLPKDALA KLSTLVSRAL VRIAKEAQRL
160 170 180 190 200
SLRFAKCTKY EIQSAMEIVL SWGLAAHCTA AALAALSLYN MSSAGGDRLG
210 220 230 240 250
RGKSARCGLT FSVGRVYRWM VDSRVALRIH EHAAIYLTAC MESLFRDIYS
260 270 280 290 300
RVVASGVPRS CSGPGSGSGS GPGPSSGPGA APAADKEREA PGGGAASGGA
310 320 330 340 350
CSAASSASGG SSCCAPPAAA AAAVPPAAAA NHHHHHHHAL HEAPKFTVET
360 370 380 390 400
LEHTVNNDSE IWGLLQPYQH LICGKNASGV LCLPDSLNLH RDPQRSNKPG
410 420 430 440 450
ELPMFSQSEL RTIEQSLLAT RVGSIAELSD LVSRAMHHLQ PLNAKHHGNG
460 470 480 490 500
TPLHHKQGAL YWEPEALYTL CYFMHCPQME WENPNVEPSK VNLQVERPFL
510 520 530 540 550
VLPPLMEWIR VAVAHAGHRR SFSMDSDDVR QAARLLLPGV DCEPRQLRAD
560 570 580 590 600
DCFCASRKLD AVAIEAKFKQ DLGFRMLNCG RTDLVKQAVS LLGPDGINTM
610 620 630 640 650
SEQGMTPLMY ACVRGDEAMV QMLLDAGADL NVEVVSTPHK YPSVHPETRH
660 670 680 690 700
WTALTFAVLH GHIPVVQLLL DAGAKVEGSV EHGEENYSET PLQLAAAVGN
710 720 730 740 750
FELVSLLLER GADPLIGTMY RNGISTTPQG DMNSFSQAAA HGHRNVFRKL
760 770 780 790 800
LAQPEKEKSD ILSLEEILAE GTDLAETAPP PLCASRNSKA KLRALREAMY
810 820 830 840 850
HSAEHGYVDV TIDIRSIGVP WTLHTWLESL RIAFQQHRRP LIQCLLKEFK
860 870 880 890 900
TIQEEEYTEE LVTQGLPLMF EILKASKNEV ISQQLCVIFT HCYGPYPIPK
910 920 930 940 950
LTEIKRKQTS RLDPHFLNNK EMSDVTFLVE GRPFYAHKVL LFTASPRFKA
960 970 980 990 1000
LLSSKPTNDG TCIEIGYVKY SIFQLVMQYL YYGGPESLLI KNNEIMELLS
1010 1020 1030 1040 1050
AAKFFQLEAL QRHCEIICAK SINTDNCVDI YNHAKFLGVT ELSAYCEGYF
1060 1070 1080 1090 1100
LKNMMVLIEN EAFKQLLYDK NGEGTGQDVL QDLQRTLAIR IQSIHLSSSK

GSVV
Length:1,104
Mass (Da):120,884
Last modified:November 24, 2009 - v3
Checksum:i118D5C668CB78A3E
GO
Isoform 2 (identifier: A6QL63-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     699-817: Missing.

Note: No experimental confirmation available.
Show »
Length:985
Mass (Da):107,867
Checksum:i143A780F66A6C711
GO
Isoform 3 (identifier: A6QL63-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     998-1104: LLSAAKFFQL...HLSSSKGSVV → VRDPLWCWLS

Note: No experimental confirmation available.
Show »
Length:1,007
Mass (Da):110,143
Checksum:i01429CBB6D70708F
GO
Isoform 4 (identifier: A6QL63-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-921: Missing.

Show »
Length:183
Mass (Da):20,686
Checksum:i8EE7B21C420B83DF
GO
Isoform 5 (identifier: A6QL63-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSN → MRKLRPKDSREPAPGSPVRSGCLQRLSHYSGIQ
     34-496: Missing.

Note: No experimental confirmation available.
Show »
Length:641
Mass (Da):71,876
Checksum:iDB1ABB3072799348
GO

Sequence cautioni

The sequence AAI01562.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI01564.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI46825.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAR21078.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC85963.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence EAW97799.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti224 – 2241R → H in AAI46825 (PubMed:15489334).Curated
Sequence conflicti361 – 3611I → V in BAC85963 (PubMed:14702039).Curated
Sequence conflicti653 – 6531A → V in BAG54475 (PubMed:14702039).Curated
Sequence conflicti1043 – 10431S → P in BAC03626 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti448 – 4481G → S.
Corresponds to variant rs1558781 [ dbSNP | Ensembl ].
VAR_055560
Natural varianti1002 – 10021A → D.
Corresponds to variant rs11610050 [ dbSNP | Ensembl ].
VAR_042534
Natural varianti1076 – 10761G → S.
Corresponds to variant rs12303478 [ dbSNP | Ensembl ].
VAR_042535

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 921921Missing in isoform 4. 1 PublicationVSP_032801Add
BLAST
Alternative sequencei1 – 3333MARRG…VRSSN → MRKLRPKDSREPAPGSPVRS GCLQRLSHYSGIQ in isoform 5. 1 PublicationVSP_045802Add
BLAST
Alternative sequencei34 – 496463Missing in isoform 5. 1 PublicationVSP_045803Add
BLAST
Alternative sequencei699 – 817119Missing in isoform 2. 1 PublicationVSP_032802Add
BLAST
Alternative sequencei998 – 1104107LLSAA…KGSVV → VRDPLWCWLS in isoform 3. 1 PublicationVSP_032803Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091276 mRNA. Translation: BAC03626.1.
AK124835 mRNA. Translation: BAC85963.1. Different initiation.
AK127295 mRNA. Translation: BAG54475.1.
AC007540 Genomic DNA. No translation available.
AC007649 Genomic DNA. No translation available.
AC009774 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97799.1. Sequence problems.
CH471054 Genomic DNA. Translation: EAW97800.1.
BC093627 mRNA. Translation: AAH93627.1.
BC093629 mRNA. Translation: AAH93629.1.
BC101561 mRNA. Translation: AAI01562.1. Different initiation.
BC101563 mRNA. Translation: AAI01564.1. Different initiation.
BC146824 mRNA. Translation: AAI46825.1. Sequence problems.
AY373588 mRNA. Translation: AAR21078.1. Different initiation.
CCDSiCCDS31893.1. [A6QL63-1]
CCDS41827.1. [A6QL63-5]
RefSeqiNP_001017523.1. NM_001017523.1. [A6QL63-5]
NP_001018082.1. NM_001018072.1. [A6QL63-1]
UniGeneiHs.271272.

Genome annotation databases

EnsembliENST00000280758; ENSP00000280758; ENSG00000151136. [A6QL63-1]
ENST00000357167; ENSP00000349690; ENSG00000151136. [A6QL63-5]
ENST00000420571; ENSP00000413889; ENSG00000151136. [A6QL63-2]
ENST00000490090; ENSP00000447319; ENSG00000151136. [A6QL63-3]
ENST00000494235; ENSP00000448322; ENSG00000151136. [A6QL63-4]
GeneIDi121551.
KEGGihsa:121551.
UCSCiuc001tmj.4. human. [A6QL63-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091276 mRNA. Translation: BAC03626.1.
AK124835 mRNA. Translation: BAC85963.1. Different initiation.
AK127295 mRNA. Translation: BAG54475.1.
AC007540 Genomic DNA. No translation available.
AC007649 Genomic DNA. No translation available.
AC009774 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97799.1. Sequence problems.
CH471054 Genomic DNA. Translation: EAW97800.1.
BC093627 mRNA. Translation: AAH93627.1.
BC093629 mRNA. Translation: AAH93629.1.
BC101561 mRNA. Translation: AAI01562.1. Different initiation.
BC101563 mRNA. Translation: AAI01564.1. Different initiation.
BC146824 mRNA. Translation: AAI46825.1. Sequence problems.
AY373588 mRNA. Translation: AAR21078.1. Different initiation.
CCDSiCCDS31893.1. [A6QL63-1]
CCDS41827.1. [A6QL63-5]
RefSeqiNP_001017523.1. NM_001017523.1. [A6QL63-5]
NP_001018082.1. NM_001018072.1. [A6QL63-1]
UniGeneiHs.271272.

3D structure databases

ProteinModelPortaliA6QL63.
SMRiA6QL63. Positions 123-248, 571-751, 919-1087.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125738. 1 interaction.
IntActiA6QL63. 1 interaction.
STRINGi9606.ENSP00000280758.

PTM databases

iPTMnetiA6QL63.
PhosphoSiteiA6QL63.

Polymorphism and mutation databases

BioMutaiBTBD11.

Proteomic databases

EPDiA6QL63.
MaxQBiA6QL63.
PaxDbiA6QL63.
PeptideAtlasiA6QL63.
PRIDEiA6QL63.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280758; ENSP00000280758; ENSG00000151136. [A6QL63-1]
ENST00000357167; ENSP00000349690; ENSG00000151136. [A6QL63-5]
ENST00000420571; ENSP00000413889; ENSG00000151136. [A6QL63-2]
ENST00000490090; ENSP00000447319; ENSG00000151136. [A6QL63-3]
ENST00000494235; ENSP00000448322; ENSG00000151136. [A6QL63-4]
GeneIDi121551.
KEGGihsa:121551.
UCSCiuc001tmj.4. human. [A6QL63-1]

Organism-specific databases

CTDi121551.
GeneCardsiBTBD11.
HGNCiHGNC:23844. BTBD11.
neXtProtiNX_A6QL63.
PharmGKBiPA134975180.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IESM. Eukaryota.
ENOG410XRDX. LUCA.
GeneTreeiENSGT00550000074669.
HOGENOMiHOG000033776.
HOVERGENiHBG050447.
InParanoidiA6QL63.
KOiK10483.
OMAiSINTENC.
OrthoDBiEOG773XF8.
PhylomeDBiA6QL63.
TreeFamiTF106437.

Miscellaneous databases

ChiTaRSiBTBD11. human.
GenomeRNAii121551.
PROiA6QL63.

Gene expression databases

BgeeiA6QL63.
CleanExiHS_BTBD11.
ExpressionAtlasiA6QL63. baseline and differential.
GenevisibleiA6QL63. HS.

Family and domain databases

Gene3Di1.10.20.10. 3 hits.
1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR000210. BTB/POZ_dom.
IPR009072. Histone-fold.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 1 hit.
PF00651. BTB. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 4 hits.
SM00225. BTB. 1 hit.
[Graphical view]
SUPFAMiSSF47113. SSF47113. 3 hits.
SSF48403. SSF48403. 1 hit.
SSF54695. SSF54695. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
PS50097. BTB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 338-1104 (ISOFORM 3).
    Tissue: Hippocampus and Tongue.
  2. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "Characterization of a novel gene containing ANK repeats and BTB domain."
    Xu J., Xie Y., Mao Y.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 550-1104 (ISOFORM 1).

Entry informationi

Entry nameiBTBDB_HUMAN
AccessioniPrimary (citable) accession number: A6QL63
Secondary accession number(s): A4FU41
, B3KXG3, C9J019, C9JK80, E9PHS4, Q3ZTQ4, Q52M89, Q6ZV99, Q8N245
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: November 24, 2009
Last modified: July 6, 2016
This is version 82 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.