SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A6NKB5

- PCX2_HUMAN

UniProt

A6NKB5 - PCX2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Pecanex-like protein 2
Gene
PCNXL2, KIAA0435
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H).2 Publications

Names & Taxonomyi

Protein namesi
Recommended name:
Pecanex-like protein 2
Gene namesi
Name:PCNXL2
Synonyms:KIAA0435
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:8736. PCNXL2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei34 – 5421Helical; Reviewed prediction
Add
BLAST
Transmembranei57 – 7721Helical; Reviewed prediction
Add
BLAST
Transmembranei844 – 86421Helical; Reviewed prediction
Add
BLAST
Transmembranei868 – 88821Helical; Reviewed prediction
Add
BLAST
Transmembranei901 – 92121Helical; Reviewed prediction
Add
BLAST
Transmembranei952 – 97221Helical; Reviewed prediction
Add
BLAST
Transmembranei983 – 100321Helical; Reviewed prediction
Add
BLAST
Transmembranei1029 – 104921Helical; Reviewed prediction
Add
BLAST
Transmembranei1099 – 111921Helical; Reviewed prediction
Add
BLAST
Transmembranei1124 – 114421Helical; Reviewed prediction
Add
BLAST
Transmembranei1193 – 121321Helical; Reviewed prediction
Add
BLAST
Transmembranei1237 – 125721Helical; Reviewed prediction
Add
BLAST
Transmembranei1265 – 128521Helical; Reviewed prediction
Add
BLAST
Transmembranei1302 – 132221Helical; Reviewed prediction
Add
BLAST
Transmembranei1324 – 134421Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33081.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21372137Pecanex-like protein 2
PRO_0000333965Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi136 – 1361N-linked (GlcNAc...) Reviewed prediction
Glycosylationi449 – 4491N-linked (GlcNAc...) Reviewed prediction
Glycosylationi550 – 5501N-linked (GlcNAc...) Reviewed prediction
Glycosylationi572 – 5721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi587 – 5871N-linked (GlcNAc...) Reviewed prediction
Glycosylationi598 – 5981N-linked (GlcNAc...) Reviewed prediction
Glycosylationi613 – 6131N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1412 – 14121N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1553 – 15531N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1818 – 18181N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2054 – 20541N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA6NKB5.
PRIDEiA6NKB5.

PTM databases

PhosphoSiteiA6NKB5.

Expressioni

Gene expression databases

ArrayExpressiA6NKB5.
BgeeiA6NKB5.
CleanExiHS_PCNXL2.
GenevestigatoriA6NKB5.

Organism-specific databases

HPAiHPA013815.
HPA014427.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000258229.

Structurei

3D structure databases

ProteinModelPortaliA6NKB5.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1937 – 2063127Ser-rich
Add
BLAST

Sequence similaritiesi

Belongs to the pecanex family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG297934.
HOVERGENiHBG108237.
InParanoidiA6NKB5.
OMAiMKDSVKD.
OrthoDBiEOG72VH54.
PhylomeDBiA6NKB5.
TreeFamiTF313570.

Family and domain databases

InterProiIPR007735. Pecanex.
[Graphical view]
PfamiPF05041. Pecanex_C. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A6NKB5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVSQVLQLLR QGVWAALTGG WYHDPEQSKF TNSCHLYLWL FLLLLPLALH     50
LAFPPNAIIV FFYCSAVTIF FTIIKLVSYR LHLMFDKGEV IQQKPSRKEE 100
KPNKDKEAKG EHITNHRNPS NNRQIHNGKK EEASRNLSTP PLRCSSRGQS 150
ITSHHSSGPL ELSAQETVED LKGVILLEDH PIAPVSSTSP GIKVESLPAS 200
QAHMLETTTK SVIPVKPVAT ETLINGKGKE RGGKGQPPLR HRSEGGLVDK 250
GPLKKLPHLS LSQYDLLETD VSFQPWGSEN SVLIPEPVSC PRGSIRERVQ 300
SKSPQDSLSS SCPQCDTIVA KPVEEPADTS CQVDTSCQGD LPLHQEVDSS 350
DSEVAVTLID TSQPGDPLSL HEPIKIVITM SSTPNSMTDL ESSLHLRVVG 400
TEKTSVKSDA EPTNPGAAGS PNAEQISIPV ITLDLPEGGG GGVPCPEGNG 450
SERTPERLKT RVSTNQCSGY GSGEGGNAIK DHSSSSREPW ESVSRLTPDT 500
GSESKVGKEG QTNLDPSSCK SSHEKRHARV LSVDSGTDVF LSKSSAEIVN 550
DTEKTMPTSK SDLEAKEGQM PNESNFLEFV SLLESINTSK MTASSQLNGS 600
AEQNEESGLL RDNCSQEKKE EILENEKPSG HSSKQGKPDL QSQDHTSTGP 650
ACTQPAKTTA FFQGNRQRQI IYRVTSQQDS SVLQVISGPE TSVQEEISVD 700
AMHVFIDEHG EIRSCYLKSG NQKEGPLQPL PSNNDCLSQA REMQVSSSST 750
TTSESQDPSS GDPAVSALQQ QLLLMVARRT QSETPRHVSQ DLEASSCSST 800
QGKFNREQFY KFIIFPGKWI KVWYDRLTLL ALLDRTEDIK ENVLAILLIV 850
LVSLLGFLTL SQGFCKDMWV LLFCLVMASC QYSLLKSVQP DPASPIHGHN 900
QIITYSRPIY FCVLCGLILL LDTGAKARHP PSYVVYGLKL FSPVFLQSAR 950
DYLIVFLYCF PAISLLGLFP QINTFCTYLL EQIDMLFFGG SAVSGITSAV 1000
YSVARSVLAA ALLHAVCFSA VKEPWSMQHI PALFSAFCGL LVALSYHLSR 1050
QSSDPSVLMS FIQCRLFPKF LHQNLAESAA DPLPKKMKDS VTDVLKWDLI 1100
VCAVVAVLSF AVSASTVFLS LRPFLSIVLF ALAGAVGFVT HYVLPQLRKH 1150
HPWMWISHPI LKNKEYHQRE VRDVAHLMWF ERLYVWLQCF EKYILYPALI 1200
LNALTIDAFL ISNHRRLGTH WDIFLMIIAG MKLLRTSFCN PVYQFINLSF 1250
TVIFFHFDYK DISESFLLDF FMVSILFSKL GDLLHKLQFV LTYVAPWQMA 1300
WGSSFHVFAQ LFAIPHSAML FFQTIATSIF STPLSPFLGS VIFITSYVRP 1350
VKFWEKNYNT RRVDNSNTRL AVQIERDPGN DDNNLNSIFY EHLTRTLQES 1400
LCGDLVLGRW GNYSSGDCFI LASDDLNAFV HLIEIGNGLV TFQLRGLEFR 1450
GTYCQQREVE AIMEGDEEDR GCCCCKPGHL PHLLSCNAAF HLRWLTWEIT 1500
QTQYILEGYS ILDNNAATML QVFDLRRILI RYYIKSIIYY MVTSPKLLSW 1550
IKNESLLKSL QPFAKWHYIE RDLAMFNINI DDDYVPCLQG ITRASFCNVY 1600
LEWIQHCARK RQEPSTTLDS DEDSPLVTLS FALCTLGRRA LGTAAHNMAI 1650
SLDSFLYGLH VLFKGDFRIT ARDEWVFADM DLLHKVVAPA IRMSLKLHQD 1700
QFTCPDEYED PAVLYEAIQS FEKKVVICHE GDPAWRGAVL SNKEELLTLR 1750
HVVDEGADEY KVIMLHRSFL SFKVIKVNKE CVRGLWAGQQ QELIFLRNRN 1800
PERGSIQNNK QVLRNLINSS CDQPLGYPMY VSPLTTSYLG THRQLKNIWG 1850
GPITLDRIRT WFWTKWVRMR KDCNARQHSG GNIEDVDGGG APTTGGNNAP 1900
SGGSQESSAE QPRKGGAQHG VSSCEGTQRT GRRKGRSQSV QAHSALSQRP 1950
PMLSSSGPIL ESRQTFLQTS TSVHELAQRL SGSRLSLHAS ATSLHSQPPP 2000
VTTTGHLSVR ERAEALIRSS LGSSTSSTLS FLFGKRSFSS ALVISGLSAA 2050
EGGNTSDTQS SSSVNIVMGP SARAASQATR HLSEPCEPPD ATEQGQLHDR 2100
CLAEAVADTL GVVCRRASQE DMGLDDTASQ QSVSDEQ 2137
Length:2,137
Mass (Da):237,277
Last modified:May 20, 2008 - v3
Checksum:i064D91B62BF84E44
GO
Isoform 2 (identifier: A6NKB5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-701: Missing.
     955-987: VFLYCFPAISLLGLFPQINTFCTYLLEQIDMLF → GKIMNSHKDFFTSEKKKDKIISAISSVIFLKSW
     988-2137: Missing.

Show »
Length:286
Mass (Da):32,206
Checksum:i6C2E4681ED159F22
GO
Isoform 3 (identifier: A6NKB5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1348: Missing.
     1349-1359: RPVKFWEKNYN → MTFYPFVASSS
     2081-2137: HLSEPCEPPD...ASQQSVSDEQ → VRGWAGLTRT...PIPFSMGLPE

Note: No experimental confirmation available.

Show »
Length:777
Mass (Da):86,628
Checksum:i35E12F71B1BCE69E
GO
Isoform 5 (identifier: A6NKB5-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     1280-1288: LGDLLHKLQ → VFLGYVRQK
     1289-2137: Missing.

Show »
Length:421
Mass (Da):48,009
Checksum:iD6C30F9210A8A1C8
GO
Isoform 4 (identifier: A6NKB5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1462: Missing.

Note: No experimental confirmation available.

Show »
Length:675
Mass (Da):75,024
Checksum:i80B564005A8ED96E
GO

Sequence cautioni

The sequence BAA23708.2 differs from that shown. Reason: Erroneous initiation.
The sequence BAB84904.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti117 – 1171R → K.
Corresponds to variant rs1033325 [ dbSNP | Ensembl ].
VAR_050479
Natural varianti454 – 4541T → A.
Corresponds to variant rs10910120 [ dbSNP | Ensembl ].
VAR_043341
Natural varianti1901 – 19011S → N.1 Publication
Corresponds to variant rs56231757 [ dbSNP | Ensembl ].
VAR_061498
Natural varianti1984 – 19841R → Q.
Corresponds to variant rs41309639 [ dbSNP | Ensembl ].
VAR_061499

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 14621462Missing in isoform 4.
VSP_033605Add
BLAST
Alternative sequencei1 – 13481348Missing in isoform 3.
VSP_033606Add
BLAST
Alternative sequencei1 – 867867Missing in isoform 5.
VSP_035048Add
BLAST
Alternative sequencei1 – 701701Missing in isoform 2.
VSP_033607Add
BLAST
Alternative sequencei955 – 98733VFLYC…IDMLF → GKIMNSHKDFFTSEKKKDKI ISAISSVIFLKSW in isoform 2.
VSP_033608Add
BLAST
Alternative sequencei988 – 21371150Missing in isoform 2.
VSP_033609Add
BLAST
Alternative sequencei1280 – 12889LGDLLHKLQ → VFLGYVRQK in isoform 5.
VSP_035049
Alternative sequencei1289 – 2137849Missing in isoform 5.
VSP_035050Add
BLAST
Alternative sequencei1349 – 135911RPVKFWEKNYN → MTFYPFVASSS in isoform 3.
VSP_033610Add
BLAST
Alternative sequencei2081 – 213757HLSEP…VSDEQ → VRGWAGLTRTGWDGGTGSWP ERGTCLAFPPFCLQNPIPFS MGLPE in isoform 3.
VSP_033611Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB007895 mRNA. Translation: BAA23708.2. Different initiation.
AK074078 mRNA. Translation: BAB84904.1. Different initiation.
AK021445 mRNA. Translation: BAB13826.1.
AL139342, AL122003, AL133289 Genomic DNA. Translation: CAI18866.1.
AL133291 Genomic DNA. No translation available.
AL133380 Genomic DNA. No translation available.
AL139342 Genomic DNA. Translation: CAI18867.1.
AL122003, AL139342, AL133289 Genomic DNA. Translation: CAI22240.1.
AL122003, AL133289 Genomic DNA. Translation: CAI22241.1.
AL133289, AL139342, AL122003 Genomic DNA. Translation: CAI22872.1.
AL133289, AL122003 Genomic DNA. Translation: CAI22873.1.
AL359819 Genomic DNA. No translation available.
BC008300 mRNA. Translation: AAH08300.2.
CCDSiCCDS44335.1. [A6NKB5-1]
RefSeqiNP_055616.3. NM_014801.3. [A6NKB5-1]
UniGeneiHs.370605.

Genome annotation databases

EnsembliENST00000258229; ENSP00000258229; ENSG00000135749. [A6NKB5-1]
ENST00000344698; ENSP00000340759; ENSG00000135749. [A6NKB5-3]
ENST00000430153; ENSP00000394703; ENSG00000135749. [A6NKB5-2]
GeneIDi80003.
KEGGihsa:80003.
UCSCiuc001hvk.1. human. [A6NKB5-3]
uc001hvl.2. human. [A6NKB5-1]
uc001hvm.2. human. [A6NKB5-4]
uc001hvq.1. human. [A6NKB5-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB007895 mRNA. Translation: BAA23708.2 . Different initiation.
AK074078 mRNA. Translation: BAB84904.1 . Different initiation.
AK021445 mRNA. Translation: BAB13826.1 .
AL139342 , AL122003 , AL133289 Genomic DNA. Translation: CAI18866.1 .
AL133291 Genomic DNA. No translation available.
AL133380 Genomic DNA. No translation available.
AL139342 Genomic DNA. Translation: CAI18867.1 .
AL122003 , AL139342 , AL133289 Genomic DNA. Translation: CAI22240.1 .
AL122003 , AL133289 Genomic DNA. Translation: CAI22241.1 .
AL133289 , AL139342 , AL122003 Genomic DNA. Translation: CAI22872.1 .
AL133289 , AL122003 Genomic DNA. Translation: CAI22873.1 .
AL359819 Genomic DNA. No translation available.
BC008300 mRNA. Translation: AAH08300.2 .
CCDSi CCDS44335.1. [A6NKB5-1 ]
RefSeqi NP_055616.3. NM_014801.3. [A6NKB5-1 ]
UniGenei Hs.370605.

3D structure databases

ProteinModelPortali A6NKB5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000258229.

PTM databases

PhosphoSitei A6NKB5.

Proteomic databases

PaxDbi A6NKB5.
PRIDEi A6NKB5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000258229 ; ENSP00000258229 ; ENSG00000135749 . [A6NKB5-1 ]
ENST00000344698 ; ENSP00000340759 ; ENSG00000135749 . [A6NKB5-3 ]
ENST00000430153 ; ENSP00000394703 ; ENSG00000135749 . [A6NKB5-2 ]
GeneIDi 80003.
KEGGi hsa:80003.
UCSCi uc001hvk.1. human. [A6NKB5-3 ]
uc001hvl.2. human. [A6NKB5-1 ]
uc001hvm.2. human. [A6NKB5-4 ]
uc001hvq.1. human. [A6NKB5-2 ]

Organism-specific databases

CTDi 80003.
GeneCardsi GC01M233119.
H-InvDB HIX0001704.
HGNCi HGNC:8736. PCNXL2.
HPAi HPA013815.
HPA014427.
neXtProti NX_A6NKB5.
PharmGKBi PA33081.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG297934.
HOVERGENi HBG108237.
InParanoidi A6NKB5.
OMAi MKDSVKD.
OrthoDBi EOG72VH54.
PhylomeDBi A6NKB5.
TreeFami TF313570.

Miscellaneous databases

ChiTaRSi PCNXL2. human.
GenomeRNAii 80003.
NextBioi 70075.
PROi A6NKB5.

Gene expression databases

ArrayExpressi A6NKB5.
Bgeei A6NKB5.
CleanExi HS_PCNXL2.
Genevestigatori A6NKB5.

Family and domain databases

InterProi IPR007735. Pecanex.
[Graphical view ]
Pfami PF05041. Pecanex_C. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
    Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ASN-1901.
    Tissue: Brain.
  2. Ohara O.
    Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Spleen.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Embryo.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Colon.
  7. "Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability."
    Kim N.-G., Rhee H., Li L.S., Kim H., Lee J.-S., Kim J.-H., Kim N.K., Kim H.
    Oncogene 21:5081-5087(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. "Chromosomal imbalances in the colorectal carcinomas with microsatellite instability."
    Li L.S., Kim N.-G., Kim S.H., Park C., Kim H., Kang H.J., Koh K.H., Kim S.N., Kim W.H., Kim N.K., Kim H.
    Am. J. Pathol. 163:1429-1436(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiPCX2_HUMAN
AccessioniPrimary (citable) accession number: A6NKB5
Secondary accession number(s): O43162
, Q5T9Z8, Q5TDF1, Q8TEP4, Q96HP9, Q9HAL8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: July 9, 2014
This is version 58 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi