Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A6NKB5

- PCX2_HUMAN

UniProt

A6NKB5 - PCX2_HUMAN

Protein

Pecanex-like protein 2

Gene

PCNXL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 59 (01 Oct 2014)
      Sequence version 3 (20 May 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H).2 Publications

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pecanex-like protein 2
    Gene namesi
    Name:PCNXL2
    Synonyms:KIAA0435
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:8736. PCNXL2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33081.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 21372137Pecanex-like protein 2PRO_0000333965Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi136 – 1361N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi449 – 4491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi550 – 5501N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi572 – 5721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi587 – 5871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi598 – 5981N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi613 – 6131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1412 – 14121N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1553 – 15531N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1818 – 18181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2054 – 20541N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiA6NKB5.
    PRIDEiA6NKB5.

    PTM databases

    PhosphoSiteiA6NKB5.

    Expressioni

    Gene expression databases

    ArrayExpressiA6NKB5.
    BgeeiA6NKB5.
    CleanExiHS_PCNXL2.
    GenevestigatoriA6NKB5.

    Organism-specific databases

    HPAiHPA013815.
    HPA014427.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000258229.

    Structurei

    3D structure databases

    ProteinModelPortaliA6NKB5.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei34 – 5421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei57 – 7721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei844 – 86421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei868 – 88821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei901 – 92121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei952 – 97221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei983 – 100321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1029 – 104921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1099 – 111921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1124 – 114421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1193 – 121321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1237 – 125721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1265 – 128521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1302 – 132221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1324 – 134421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1937 – 2063127Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the pecanex family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG297934.
    HOVERGENiHBG108237.
    InParanoidiA6NKB5.
    OMAiMKDSVKD.
    OrthoDBiEOG72VH54.
    PhylomeDBiA6NKB5.
    TreeFamiTF313570.

    Family and domain databases

    InterProiIPR007735. Pecanex.
    [Graphical view]
    PfamiPF05041. Pecanex_C. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A6NKB5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVSQVLQLLR QGVWAALTGG WYHDPEQSKF TNSCHLYLWL FLLLLPLALH     50
    LAFPPNAIIV FFYCSAVTIF FTIIKLVSYR LHLMFDKGEV IQQKPSRKEE 100
    KPNKDKEAKG EHITNHRNPS NNRQIHNGKK EEASRNLSTP PLRCSSRGQS 150
    ITSHHSSGPL ELSAQETVED LKGVILLEDH PIAPVSSTSP GIKVESLPAS 200
    QAHMLETTTK SVIPVKPVAT ETLINGKGKE RGGKGQPPLR HRSEGGLVDK 250
    GPLKKLPHLS LSQYDLLETD VSFQPWGSEN SVLIPEPVSC PRGSIRERVQ 300
    SKSPQDSLSS SCPQCDTIVA KPVEEPADTS CQVDTSCQGD LPLHQEVDSS 350
    DSEVAVTLID TSQPGDPLSL HEPIKIVITM SSTPNSMTDL ESSLHLRVVG 400
    TEKTSVKSDA EPTNPGAAGS PNAEQISIPV ITLDLPEGGG GGVPCPEGNG 450
    SERTPERLKT RVSTNQCSGY GSGEGGNAIK DHSSSSREPW ESVSRLTPDT 500
    GSESKVGKEG QTNLDPSSCK SSHEKRHARV LSVDSGTDVF LSKSSAEIVN 550
    DTEKTMPTSK SDLEAKEGQM PNESNFLEFV SLLESINTSK MTASSQLNGS 600
    AEQNEESGLL RDNCSQEKKE EILENEKPSG HSSKQGKPDL QSQDHTSTGP 650
    ACTQPAKTTA FFQGNRQRQI IYRVTSQQDS SVLQVISGPE TSVQEEISVD 700
    AMHVFIDEHG EIRSCYLKSG NQKEGPLQPL PSNNDCLSQA REMQVSSSST 750
    TTSESQDPSS GDPAVSALQQ QLLLMVARRT QSETPRHVSQ DLEASSCSST 800
    QGKFNREQFY KFIIFPGKWI KVWYDRLTLL ALLDRTEDIK ENVLAILLIV 850
    LVSLLGFLTL SQGFCKDMWV LLFCLVMASC QYSLLKSVQP DPASPIHGHN 900
    QIITYSRPIY FCVLCGLILL LDTGAKARHP PSYVVYGLKL FSPVFLQSAR 950
    DYLIVFLYCF PAISLLGLFP QINTFCTYLL EQIDMLFFGG SAVSGITSAV 1000
    YSVARSVLAA ALLHAVCFSA VKEPWSMQHI PALFSAFCGL LVALSYHLSR 1050
    QSSDPSVLMS FIQCRLFPKF LHQNLAESAA DPLPKKMKDS VTDVLKWDLI 1100
    VCAVVAVLSF AVSASTVFLS LRPFLSIVLF ALAGAVGFVT HYVLPQLRKH 1150
    HPWMWISHPI LKNKEYHQRE VRDVAHLMWF ERLYVWLQCF EKYILYPALI 1200
    LNALTIDAFL ISNHRRLGTH WDIFLMIIAG MKLLRTSFCN PVYQFINLSF 1250
    TVIFFHFDYK DISESFLLDF FMVSILFSKL GDLLHKLQFV LTYVAPWQMA 1300
    WGSSFHVFAQ LFAIPHSAML FFQTIATSIF STPLSPFLGS VIFITSYVRP 1350
    VKFWEKNYNT RRVDNSNTRL AVQIERDPGN DDNNLNSIFY EHLTRTLQES 1400
    LCGDLVLGRW GNYSSGDCFI LASDDLNAFV HLIEIGNGLV TFQLRGLEFR 1450
    GTYCQQREVE AIMEGDEEDR GCCCCKPGHL PHLLSCNAAF HLRWLTWEIT 1500
    QTQYILEGYS ILDNNAATML QVFDLRRILI RYYIKSIIYY MVTSPKLLSW 1550
    IKNESLLKSL QPFAKWHYIE RDLAMFNINI DDDYVPCLQG ITRASFCNVY 1600
    LEWIQHCARK RQEPSTTLDS DEDSPLVTLS FALCTLGRRA LGTAAHNMAI 1650
    SLDSFLYGLH VLFKGDFRIT ARDEWVFADM DLLHKVVAPA IRMSLKLHQD 1700
    QFTCPDEYED PAVLYEAIQS FEKKVVICHE GDPAWRGAVL SNKEELLTLR 1750
    HVVDEGADEY KVIMLHRSFL SFKVIKVNKE CVRGLWAGQQ QELIFLRNRN 1800
    PERGSIQNNK QVLRNLINSS CDQPLGYPMY VSPLTTSYLG THRQLKNIWG 1850
    GPITLDRIRT WFWTKWVRMR KDCNARQHSG GNIEDVDGGG APTTGGNNAP 1900
    SGGSQESSAE QPRKGGAQHG VSSCEGTQRT GRRKGRSQSV QAHSALSQRP 1950
    PMLSSSGPIL ESRQTFLQTS TSVHELAQRL SGSRLSLHAS ATSLHSQPPP 2000
    VTTTGHLSVR ERAEALIRSS LGSSTSSTLS FLFGKRSFSS ALVISGLSAA 2050
    EGGNTSDTQS SSSVNIVMGP SARAASQATR HLSEPCEPPD ATEQGQLHDR 2100
    CLAEAVADTL GVVCRRASQE DMGLDDTASQ QSVSDEQ 2137
    Length:2,137
    Mass (Da):237,277
    Last modified:May 20, 2008 - v3
    Checksum:i064D91B62BF84E44
    GO
    Isoform 2 (identifier: A6NKB5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-701: Missing.
         955-987: VFLYCFPAISLLGLFPQINTFCTYLLEQIDMLF → GKIMNSHKDFFTSEKKKDKIISAISSVIFLKSW
         988-2137: Missing.

    Show »
    Length:286
    Mass (Da):32,206
    Checksum:i6C2E4681ED159F22
    GO
    Isoform 3 (identifier: A6NKB5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1348: Missing.
         1349-1359: RPVKFWEKNYN → MTFYPFVASSS
         2081-2137: HLSEPCEPPD...ASQQSVSDEQ → VRGWAGLTRT...PIPFSMGLPE

    Note: No experimental confirmation available.

    Show »
    Length:777
    Mass (Da):86,628
    Checksum:i35E12F71B1BCE69E
    GO
    Isoform 5 (identifier: A6NKB5-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-867: Missing.
         1280-1288: LGDLLHKLQ → VFLGYVRQK
         1289-2137: Missing.

    Show »
    Length:421
    Mass (Da):48,009
    Checksum:iD6C30F9210A8A1C8
    GO
    Isoform 4 (identifier: A6NKB5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1462: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:675
    Mass (Da):75,024
    Checksum:i80B564005A8ED96E
    GO

    Sequence cautioni

    The sequence BAA23708.2 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB84904.1 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti117 – 1171R → K.
    Corresponds to variant rs1033325 [ dbSNP | Ensembl ].
    VAR_050479
    Natural varianti454 – 4541T → A.
    Corresponds to variant rs10910120 [ dbSNP | Ensembl ].
    VAR_043341
    Natural varianti1901 – 19011S → N.1 Publication
    Corresponds to variant rs56231757 [ dbSNP | Ensembl ].
    VAR_061498
    Natural varianti1984 – 19841R → Q.
    Corresponds to variant rs41309639 [ dbSNP | Ensembl ].
    VAR_061499

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 14621462Missing in isoform 4. 1 PublicationVSP_033605Add
    BLAST
    Alternative sequencei1 – 13481348Missing in isoform 3. 1 PublicationVSP_033606Add
    BLAST
    Alternative sequencei1 – 867867Missing in isoform 5. 1 PublicationVSP_035048Add
    BLAST
    Alternative sequencei1 – 701701Missing in isoform 2. 1 PublicationVSP_033607Add
    BLAST
    Alternative sequencei955 – 98733VFLYC…IDMLF → GKIMNSHKDFFTSEKKKDKI ISAISSVIFLKSW in isoform 2. 1 PublicationVSP_033608Add
    BLAST
    Alternative sequencei988 – 21371150Missing in isoform 2. 1 PublicationVSP_033609Add
    BLAST
    Alternative sequencei1280 – 12889LGDLLHKLQ → VFLGYVRQK in isoform 5. 1 PublicationVSP_035049
    Alternative sequencei1289 – 2137849Missing in isoform 5. 1 PublicationVSP_035050Add
    BLAST
    Alternative sequencei1349 – 135911RPVKFWEKNYN → MTFYPFVASSS in isoform 3. 1 PublicationVSP_033610Add
    BLAST
    Alternative sequencei2081 – 213757HLSEP…VSDEQ → VRGWAGLTRTGWDGGTGSWP ERGTCLAFPPFCLQNPIPFS MGLPE in isoform 3. 1 PublicationVSP_033611Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB007895 mRNA. Translation: BAA23708.2. Different initiation.
    AK074078 mRNA. Translation: BAB84904.1. Different initiation.
    AK021445 mRNA. Translation: BAB13826.1.
    AL139342, AL122003, AL133289 Genomic DNA. Translation: CAI18866.1.
    AL133291 Genomic DNA. No translation available.
    AL133380 Genomic DNA. No translation available.
    AL139342 Genomic DNA. Translation: CAI18867.1.
    AL122003, AL139342, AL133289 Genomic DNA. Translation: CAI22240.1.
    AL122003, AL133289 Genomic DNA. Translation: CAI22241.1.
    AL133289, AL139342, AL122003 Genomic DNA. Translation: CAI22872.1.
    AL133289, AL122003 Genomic DNA. Translation: CAI22873.1.
    AL359819 Genomic DNA. No translation available.
    BC008300 mRNA. Translation: AAH08300.2.
    CCDSiCCDS44335.1. [A6NKB5-1]
    RefSeqiNP_055616.3. NM_014801.3. [A6NKB5-1]
    UniGeneiHs.370605.

    Genome annotation databases

    EnsembliENST00000258229; ENSP00000258229; ENSG00000135749. [A6NKB5-1]
    ENST00000344698; ENSP00000340759; ENSG00000135749. [A6NKB5-3]
    ENST00000430153; ENSP00000394703; ENSG00000135749. [A6NKB5-2]
    GeneIDi80003.
    KEGGihsa:80003.
    UCSCiuc001hvk.1. human. [A6NKB5-3]
    uc001hvl.2. human. [A6NKB5-1]
    uc001hvm.2. human. [A6NKB5-4]
    uc001hvq.1. human. [A6NKB5-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB007895 mRNA. Translation: BAA23708.2 . Different initiation.
    AK074078 mRNA. Translation: BAB84904.1 . Different initiation.
    AK021445 mRNA. Translation: BAB13826.1 .
    AL139342 , AL122003 , AL133289 Genomic DNA. Translation: CAI18866.1 .
    AL133291 Genomic DNA. No translation available.
    AL133380 Genomic DNA. No translation available.
    AL139342 Genomic DNA. Translation: CAI18867.1 .
    AL122003 , AL139342 , AL133289 Genomic DNA. Translation: CAI22240.1 .
    AL122003 , AL133289 Genomic DNA. Translation: CAI22241.1 .
    AL133289 , AL139342 , AL122003 Genomic DNA. Translation: CAI22872.1 .
    AL133289 , AL122003 Genomic DNA. Translation: CAI22873.1 .
    AL359819 Genomic DNA. No translation available.
    BC008300 mRNA. Translation: AAH08300.2 .
    CCDSi CCDS44335.1. [A6NKB5-1 ]
    RefSeqi NP_055616.3. NM_014801.3. [A6NKB5-1 ]
    UniGenei Hs.370605.

    3D structure databases

    ProteinModelPortali A6NKB5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000258229.

    PTM databases

    PhosphoSitei A6NKB5.

    Proteomic databases

    PaxDbi A6NKB5.
    PRIDEi A6NKB5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000258229 ; ENSP00000258229 ; ENSG00000135749 . [A6NKB5-1 ]
    ENST00000344698 ; ENSP00000340759 ; ENSG00000135749 . [A6NKB5-3 ]
    ENST00000430153 ; ENSP00000394703 ; ENSG00000135749 . [A6NKB5-2 ]
    GeneIDi 80003.
    KEGGi hsa:80003.
    UCSCi uc001hvk.1. human. [A6NKB5-3 ]
    uc001hvl.2. human. [A6NKB5-1 ]
    uc001hvm.2. human. [A6NKB5-4 ]
    uc001hvq.1. human. [A6NKB5-2 ]

    Organism-specific databases

    CTDi 80003.
    GeneCardsi GC01M233119.
    H-InvDB HIX0001704.
    HGNCi HGNC:8736. PCNXL2.
    HPAi HPA013815.
    HPA014427.
    neXtProti NX_A6NKB5.
    PharmGKBi PA33081.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG297934.
    HOVERGENi HBG108237.
    InParanoidi A6NKB5.
    OMAi MKDSVKD.
    OrthoDBi EOG72VH54.
    PhylomeDBi A6NKB5.
    TreeFami TF313570.

    Miscellaneous databases

    ChiTaRSi PCNXL2. human.
    GenomeRNAii 80003.
    NextBioi 70075.
    PROi A6NKB5.

    Gene expression databases

    ArrayExpressi A6NKB5.
    Bgeei A6NKB5.
    CleanExi HS_PCNXL2.
    Genevestigatori A6NKB5.

    Family and domain databases

    InterProi IPR007735. Pecanex.
    [Graphical view ]
    Pfami PF05041. Pecanex_C. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
      Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ASN-1901.
      Tissue: Brain.
    2. Ohara O.
      Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
      Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
      Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Spleen.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Embryo.
    5. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Colon.
    7. "Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability."
      Kim N.-G., Rhee H., Li L.S., Kim H., Lee J.-S., Kim J.-H., Kim N.K., Kim H.
      Oncogene 21:5081-5087(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    8. "Chromosomal imbalances in the colorectal carcinomas with microsatellite instability."
      Li L.S., Kim N.-G., Kim S.H., Park C., Kim H., Kang H.J., Koh K.H., Kim S.N., Kim W.H., Kim N.K., Kim H.
      Am. J. Pathol. 163:1429-1436(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiPCX2_HUMAN
    AccessioniPrimary (citable) accession number: A6NKB5
    Secondary accession number(s): O43162
    , Q5T9Z8, Q5TDF1, Q8TEP4, Q96HP9, Q9HAL8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 20, 2008
    Last sequence update: May 20, 2008
    Last modified: October 1, 2014
    This is version 59 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3