A6NKB5 (PCX2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 49.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pecanex-like protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2137 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H). Ref.7 Ref.8 |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Miscellaneous | PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors. |
| Sequence similarities | Belongs to the pecanex family. |
| Sequence caution | The sequence BAA23708.2 differs from that shown. Reason: Erroneous initiation. The sequence BAB84904.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A6NKB5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A6NKB5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-701: Missing. 955-987: VFLYCFPAISLLGLFPQINTFCTYLLEQIDMLF → GKIMNSHKDFFTSEKKKDKIISAISSVIFLKSW 988-2137: Missing. | ||||||
| Isoform 3 (identifier: A6NKB5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1348: Missing. 1349-1359: RPVKFWEKNYN → MTFYPFVASSS 2081-2137: HLSEPCEPPD...ASQQSVSDEQ → VRGWAGLTRT...PIPFSMGLPE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: A6NKB5-5) The sequence of this isoform differs from the canonical sequence as follows: 1-867: Missing. 1280-1288: LGDLLHKLQ → VFLGYVRQK 1289-2137: Missing. | ||||||
| Isoform 4 (identifier: A6NKB5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1462: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2137 | 2137 | Pecanex-like protein 2 | PRO_0000333965 | |||||
Regions | |||||||||
| Transmembrane | 34 – 54 | 21 | Helical; Potential | ||||||
| Transmembrane | 57 – 77 | 21 | Helical; Potential | ||||||
| Transmembrane | 844 – 864 | 21 | Helical; Potential | ||||||
| Transmembrane | 868 – 888 | 21 | Helical; Potential | ||||||
| Transmembrane | 901 – 921 | 21 | Helical; Potential | ||||||
| Transmembrane | 952 – 972 | 21 | Helical; Potential | ||||||
| Transmembrane | 983 – 1003 | 21 | Helical; Potential | ||||||
| Transmembrane | 1029 – 1049 | 21 | Helical; Potential | ||||||
| Transmembrane | 1099 – 1119 | 21 | Helical; Potential | ||||||
| Transmembrane | 1124 – 1144 | 21 | Helical; Potential | ||||||
| Transmembrane | 1193 – 1213 | 21 | Helical; Potential | ||||||
| Transmembrane | 1237 – 1257 | 21 | Helical; Potential | ||||||
| Transmembrane | 1265 – 1285 | 21 | Helical; Potential | ||||||
| Transmembrane | 1302 – 1322 | 21 | Helical; Potential | ||||||
| Transmembrane | 1324 – 1344 | 21 | Helical; Potential | ||||||
| Compositional bias | 1937 – 2063 | 127 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 136 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 449 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 550 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 572 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 587 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 598 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 613 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1412 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1553 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1818 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 2054 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 1462 | 1462 | Missing in isoform 4. | VSP_033605 | |||||
| Alternative sequence | 1 – 1348 | 1348 | Missing in isoform 3. | VSP_033606 | |||||
| Alternative sequence | 1 – 867 | 867 | Missing in isoform 5. | VSP_035048 | |||||
| Alternative sequence | 1 – 701 | 701 | Missing in isoform 2. | VSP_033607 | |||||
| Alternative sequence | 955 – 987 | 33 | VFLYC…IDMLF → GKIMNSHKDFFTSEKKKDKI ISAISSVIFLKSW in isoform 2. | VSP_033608 | |||||
| Alternative sequence | 988 – 2137 | 1150 | Missing in isoform 2. | VSP_033609 | |||||
| Alternative sequence | 1280 – 1288 | 9 | LGDLLHKLQ → VFLGYVRQK in isoform 5. | VSP_035049 | |||||
| Alternative sequence | 1289 – 2137 | 849 | Missing in isoform 5. | VSP_035050 | |||||
| Alternative sequence | 1349 – 1359 | 11 | RPVKFWEKNYN → MTFYPFVASSS in isoform 3. | VSP_033610 | |||||
| Alternative sequence | 2081 – 2137 | 57 | HLSEP…VSDEQ → VRGWAGLTRTGWDGGTGSWP ERGTCLAFPPFCLQNPIPFS MGLPE in isoform 3. | VSP_033611 | |||||
| Natural variant | 117 | 1 | R → K. Corresponds to variant rs1033325 [ dbSNP | Ensembl ]. | VAR_050479 | |||||
| Natural variant | 454 | 1 | T → A. Corresponds to variant rs10910120 [ dbSNP | Ensembl ]. | VAR_043341 | |||||
| Natural variant | 1901 | 1 | S → N. Ref.1 Corresponds to variant rs56231757 [ dbSNP | Ensembl ]. | VAR_061498 | |||||
| Natural variant | 1984 | 1 | R → Q. Corresponds to variant rs41309639 [ dbSNP | Ensembl ]. | VAR_061499 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro." Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ASN-1901. Tissue: Brain. |
| [2] | Ohara O. Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "The nucleotide sequence of a long cDNA clone isolated from human spleen." Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Spleen. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Embryo. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Colon. |
| [7] | "Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability." Kim N.-G., Rhee H., Li L.S., Kim H., Lee J.-S., Kim J.-H., Kim N.K., Kim H. Oncogene 21:5081-5087(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "Chromosomal imbalances in the colorectal carcinomas with microsatellite instability." Li L.S., Kim N.-G., Kim S.H., Park C., Kim H., Kang H.J., Koh K.H., Kim S.N., Kim W.H., Kim N.K., Kim H. Am. J. Pathol. 163:1429-1436(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB007895 mRNA. Translation: BAA23708.2. Different initiation. AK074078 mRNA. Translation: BAB84904.1. Different initiation. AK021445 mRNA. Translation: BAB13826.1. AL139342, AL122003, AL133289 Genomic DNA. Translation: CAI18866.1. AL133291 Genomic DNA. No translation available. AL133380 Genomic DNA. No translation available. AL139342 Genomic DNA. Translation: CAI18867.1. AL122003, AL139342, AL133289 Genomic DNA. Translation: CAI22240.1. AL122003, AL133289 Genomic DNA. Translation: CAI22241.1. AL133289, AL139342, AL122003 Genomic DNA. Translation: CAI22872.1. AL133289, AL122003 Genomic DNA. Translation: CAI22873.1. AL359819 Genomic DNA. No translation available. BC008300 mRNA. Translation: AAH08300.2. |
| IPI | IPI00015501. IPI00186853. IPI00514056. IPI00893561. IPI00902808. |
| RefSeq | NP_055616.3. NM_014801.3. |
| UniGene | Hs.370605. |
3D structure databases | |
| ProteinModelPortal | A6NKB5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000258229. |
PTM databases | |
| PhosphoSite | A6NKB5. |
Proteomic databases | |
| PaxDb | A6NKB5. |
| PRIDE | A6NKB5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000258229; ENSP00000258229; ENSG00000135749. ENST00000344698; ENSP00000340759; ENSG00000135749. ENST00000430153; ENSP00000394703; ENSG00000135749. |
| GeneID | 80003. |
| KEGG | hsa:80003. |
| UCSC | uc001hvk.1. human. uc001hvl.2. human. uc001hvq.1. human. |
Organism-specific databases | |
| CTD | 80003. |
| GeneCards | GC01M233119. |
| H-InvDB | HIX0001704. |
| HGNC | HGNC:8736. PCNXL2. |
| HPA | HPA013815. HPA014427. |
| neXtProt | NX_A6NKB5. |
| PharmGKB | PA33081. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG297934. |
| HOVERGEN | HBG108237. |
| InParanoid | A6NKB5. |
| OMA | MKDSVKD. |
Gene expression databases | |
| ArrayExpress | A6NKB5. |
| Bgee | A6NKB5. |
| CleanEx | HS_PCNXL2. |
| Genevestigator | A6NKB5. |
Family and domain databases | |
| InterPro | IPR007735. Pecanex. [Graphical view] |
| Pfam | PF05041. Pecanex_C. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PCNXL2. human. |
| GenomeRNAi | 80003. |
| NextBio | 70075. |
Entry information
| Entry name | PCX2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A6NKB5 Secondary accession number(s): O43162 Q9HAL8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
