Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A6NKB5

- PCX2_HUMAN

UniProt

A6NKB5 - PCX2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pecanex-like protein 2

Gene

PCNXL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H).2 Publications

Names & Taxonomyi

Protein namesi
Recommended name:
Pecanex-like protein 2
Gene namesi
Name:PCNXL2
Synonyms:KIAA0435
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:8736. PCNXL2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei34 – 5421HelicalSequence AnalysisAdd
BLAST
Transmembranei57 – 7721HelicalSequence AnalysisAdd
BLAST
Transmembranei844 – 86421HelicalSequence AnalysisAdd
BLAST
Transmembranei868 – 88821HelicalSequence AnalysisAdd
BLAST
Transmembranei901 – 92121HelicalSequence AnalysisAdd
BLAST
Transmembranei952 – 97221HelicalSequence AnalysisAdd
BLAST
Transmembranei983 – 100321HelicalSequence AnalysisAdd
BLAST
Transmembranei1029 – 104921HelicalSequence AnalysisAdd
BLAST
Transmembranei1099 – 111921HelicalSequence AnalysisAdd
BLAST
Transmembranei1124 – 114421HelicalSequence AnalysisAdd
BLAST
Transmembranei1193 – 121321HelicalSequence AnalysisAdd
BLAST
Transmembranei1237 – 125721HelicalSequence AnalysisAdd
BLAST
Transmembranei1265 – 128521HelicalSequence AnalysisAdd
BLAST
Transmembranei1302 – 132221HelicalSequence AnalysisAdd
BLAST
Transmembranei1324 – 134421HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33081.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21372137Pecanex-like protein 2PRO_0000333965Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi136 – 1361N-linked (GlcNAc...)Sequence Analysis
Glycosylationi449 – 4491N-linked (GlcNAc...)Sequence Analysis
Glycosylationi550 – 5501N-linked (GlcNAc...)Sequence Analysis
Glycosylationi572 – 5721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi587 – 5871N-linked (GlcNAc...)Sequence Analysis
Glycosylationi598 – 5981N-linked (GlcNAc...)Sequence Analysis
Glycosylationi613 – 6131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1412 – 14121N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1553 – 15531N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1818 – 18181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2054 – 20541N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA6NKB5.
PRIDEiA6NKB5.

PTM databases

PhosphoSiteiA6NKB5.

Expressioni

Gene expression databases

BgeeiA6NKB5.
CleanExiHS_PCNXL2.
ExpressionAtlasiA6NKB5. baseline and differential.
GenevestigatoriA6NKB5.

Organism-specific databases

HPAiHPA013815.
HPA014427.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000258229.

Structurei

3D structure databases

ProteinModelPortaliA6NKB5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1937 – 2063127Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the pecanex family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG297934.
GeneTreeiENSGT00390000013164.
HOVERGENiHBG108237.
InParanoidiA6NKB5.
OMAiMKDSVKD.
OrthoDBiEOG72VH54.
PhylomeDBiA6NKB5.
TreeFamiTF313570.

Family and domain databases

InterProiIPR007735. Pecanex.
[Graphical view]
PfamiPF05041. Pecanex_C. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A6NKB5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSQVLQLLR QGVWAALTGG WYHDPEQSKF TNSCHLYLWL FLLLLPLALH
60 70 80 90 100
LAFPPNAIIV FFYCSAVTIF FTIIKLVSYR LHLMFDKGEV IQQKPSRKEE
110 120 130 140 150
KPNKDKEAKG EHITNHRNPS NNRQIHNGKK EEASRNLSTP PLRCSSRGQS
160 170 180 190 200
ITSHHSSGPL ELSAQETVED LKGVILLEDH PIAPVSSTSP GIKVESLPAS
210 220 230 240 250
QAHMLETTTK SVIPVKPVAT ETLINGKGKE RGGKGQPPLR HRSEGGLVDK
260 270 280 290 300
GPLKKLPHLS LSQYDLLETD VSFQPWGSEN SVLIPEPVSC PRGSIRERVQ
310 320 330 340 350
SKSPQDSLSS SCPQCDTIVA KPVEEPADTS CQVDTSCQGD LPLHQEVDSS
360 370 380 390 400
DSEVAVTLID TSQPGDPLSL HEPIKIVITM SSTPNSMTDL ESSLHLRVVG
410 420 430 440 450
TEKTSVKSDA EPTNPGAAGS PNAEQISIPV ITLDLPEGGG GGVPCPEGNG
460 470 480 490 500
SERTPERLKT RVSTNQCSGY GSGEGGNAIK DHSSSSREPW ESVSRLTPDT
510 520 530 540 550
GSESKVGKEG QTNLDPSSCK SSHEKRHARV LSVDSGTDVF LSKSSAEIVN
560 570 580 590 600
DTEKTMPTSK SDLEAKEGQM PNESNFLEFV SLLESINTSK MTASSQLNGS
610 620 630 640 650
AEQNEESGLL RDNCSQEKKE EILENEKPSG HSSKQGKPDL QSQDHTSTGP
660 670 680 690 700
ACTQPAKTTA FFQGNRQRQI IYRVTSQQDS SVLQVISGPE TSVQEEISVD
710 720 730 740 750
AMHVFIDEHG EIRSCYLKSG NQKEGPLQPL PSNNDCLSQA REMQVSSSST
760 770 780 790 800
TTSESQDPSS GDPAVSALQQ QLLLMVARRT QSETPRHVSQ DLEASSCSST
810 820 830 840 850
QGKFNREQFY KFIIFPGKWI KVWYDRLTLL ALLDRTEDIK ENVLAILLIV
860 870 880 890 900
LVSLLGFLTL SQGFCKDMWV LLFCLVMASC QYSLLKSVQP DPASPIHGHN
910 920 930 940 950
QIITYSRPIY FCVLCGLILL LDTGAKARHP PSYVVYGLKL FSPVFLQSAR
960 970 980 990 1000
DYLIVFLYCF PAISLLGLFP QINTFCTYLL EQIDMLFFGG SAVSGITSAV
1010 1020 1030 1040 1050
YSVARSVLAA ALLHAVCFSA VKEPWSMQHI PALFSAFCGL LVALSYHLSR
1060 1070 1080 1090 1100
QSSDPSVLMS FIQCRLFPKF LHQNLAESAA DPLPKKMKDS VTDVLKWDLI
1110 1120 1130 1140 1150
VCAVVAVLSF AVSASTVFLS LRPFLSIVLF ALAGAVGFVT HYVLPQLRKH
1160 1170 1180 1190 1200
HPWMWISHPI LKNKEYHQRE VRDVAHLMWF ERLYVWLQCF EKYILYPALI
1210 1220 1230 1240 1250
LNALTIDAFL ISNHRRLGTH WDIFLMIIAG MKLLRTSFCN PVYQFINLSF
1260 1270 1280 1290 1300
TVIFFHFDYK DISESFLLDF FMVSILFSKL GDLLHKLQFV LTYVAPWQMA
1310 1320 1330 1340 1350
WGSSFHVFAQ LFAIPHSAML FFQTIATSIF STPLSPFLGS VIFITSYVRP
1360 1370 1380 1390 1400
VKFWEKNYNT RRVDNSNTRL AVQIERDPGN DDNNLNSIFY EHLTRTLQES
1410 1420 1430 1440 1450
LCGDLVLGRW GNYSSGDCFI LASDDLNAFV HLIEIGNGLV TFQLRGLEFR
1460 1470 1480 1490 1500
GTYCQQREVE AIMEGDEEDR GCCCCKPGHL PHLLSCNAAF HLRWLTWEIT
1510 1520 1530 1540 1550
QTQYILEGYS ILDNNAATML QVFDLRRILI RYYIKSIIYY MVTSPKLLSW
1560 1570 1580 1590 1600
IKNESLLKSL QPFAKWHYIE RDLAMFNINI DDDYVPCLQG ITRASFCNVY
1610 1620 1630 1640 1650
LEWIQHCARK RQEPSTTLDS DEDSPLVTLS FALCTLGRRA LGTAAHNMAI
1660 1670 1680 1690 1700
SLDSFLYGLH VLFKGDFRIT ARDEWVFADM DLLHKVVAPA IRMSLKLHQD
1710 1720 1730 1740 1750
QFTCPDEYED PAVLYEAIQS FEKKVVICHE GDPAWRGAVL SNKEELLTLR
1760 1770 1780 1790 1800
HVVDEGADEY KVIMLHRSFL SFKVIKVNKE CVRGLWAGQQ QELIFLRNRN
1810 1820 1830 1840 1850
PERGSIQNNK QVLRNLINSS CDQPLGYPMY VSPLTTSYLG THRQLKNIWG
1860 1870 1880 1890 1900
GPITLDRIRT WFWTKWVRMR KDCNARQHSG GNIEDVDGGG APTTGGNNAP
1910 1920 1930 1940 1950
SGGSQESSAE QPRKGGAQHG VSSCEGTQRT GRRKGRSQSV QAHSALSQRP
1960 1970 1980 1990 2000
PMLSSSGPIL ESRQTFLQTS TSVHELAQRL SGSRLSLHAS ATSLHSQPPP
2010 2020 2030 2040 2050
VTTTGHLSVR ERAEALIRSS LGSSTSSTLS FLFGKRSFSS ALVISGLSAA
2060 2070 2080 2090 2100
EGGNTSDTQS SSSVNIVMGP SARAASQATR HLSEPCEPPD ATEQGQLHDR
2110 2120 2130
CLAEAVADTL GVVCRRASQE DMGLDDTASQ QSVSDEQ
Length:2,137
Mass (Da):237,277
Last modified:May 20, 2008 - v3
Checksum:i064D91B62BF84E44
GO
Isoform 2 (identifier: A6NKB5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-701: Missing.
     955-987: VFLYCFPAISLLGLFPQINTFCTYLLEQIDMLF → GKIMNSHKDFFTSEKKKDKIISAISSVIFLKSW
     988-2137: Missing.

Show »
Length:286
Mass (Da):32,206
Checksum:i6C2E4681ED159F22
GO
Isoform 3 (identifier: A6NKB5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1348: Missing.
     1349-1359: RPVKFWEKNYN → MTFYPFVASSS
     2081-2137: HLSEPCEPPD...ASQQSVSDEQ → VRGWAGLTRT...PIPFSMGLPE

Note: No experimental confirmation available.

Show »
Length:777
Mass (Da):86,628
Checksum:i35E12F71B1BCE69E
GO
Isoform 5 (identifier: A6NKB5-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     1280-1288: LGDLLHKLQ → VFLGYVRQK
     1289-2137: Missing.

Show »
Length:421
Mass (Da):48,009
Checksum:iD6C30F9210A8A1C8
GO
Isoform 4 (identifier: A6NKB5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1462: Missing.

Note: No experimental confirmation available.

Show »
Length:675
Mass (Da):75,024
Checksum:i80B564005A8ED96E
GO

Sequence cautioni

The sequence BAA23708.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB84904.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti117 – 1171R → K.
Corresponds to variant rs1033325 [ dbSNP | Ensembl ].
VAR_050479
Natural varianti454 – 4541T → A.
Corresponds to variant rs10910120 [ dbSNP | Ensembl ].
VAR_043341
Natural varianti1901 – 19011S → N.1 Publication
Corresponds to variant rs56231757 [ dbSNP | Ensembl ].
VAR_061498
Natural varianti1984 – 19841R → Q.
Corresponds to variant rs41309639 [ dbSNP | Ensembl ].
VAR_061499

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 14621462Missing in isoform 4. 1 PublicationVSP_033605Add
BLAST
Alternative sequencei1 – 13481348Missing in isoform 3. 1 PublicationVSP_033606Add
BLAST
Alternative sequencei1 – 867867Missing in isoform 5. 1 PublicationVSP_035048Add
BLAST
Alternative sequencei1 – 701701Missing in isoform 2. 1 PublicationVSP_033607Add
BLAST
Alternative sequencei955 – 98733VFLYC…IDMLF → GKIMNSHKDFFTSEKKKDKI ISAISSVIFLKSW in isoform 2. 1 PublicationVSP_033608Add
BLAST
Alternative sequencei988 – 21371150Missing in isoform 2. 1 PublicationVSP_033609Add
BLAST
Alternative sequencei1280 – 12889LGDLLHKLQ → VFLGYVRQK in isoform 5. 1 PublicationVSP_035049
Alternative sequencei1289 – 2137849Missing in isoform 5. 1 PublicationVSP_035050Add
BLAST
Alternative sequencei1349 – 135911RPVKFWEKNYN → MTFYPFVASSS in isoform 3. 1 PublicationVSP_033610Add
BLAST
Alternative sequencei2081 – 213757HLSEP…VSDEQ → VRGWAGLTRTGWDGGTGSWP ERGTCLAFPPFCLQNPIPFS MGLPE in isoform 3. 1 PublicationVSP_033611Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007895 mRNA. Translation: BAA23708.2. Different initiation.
AK074078 mRNA. Translation: BAB84904.1. Different initiation.
AK021445 mRNA. Translation: BAB13826.1.
AL139342, AL122003, AL133289 Genomic DNA. Translation: CAI18866.1.
AL133291 Genomic DNA. No translation available.
AL133380 Genomic DNA. No translation available.
AL139342 Genomic DNA. Translation: CAI18867.1.
AL122003, AL139342, AL133289 Genomic DNA. Translation: CAI22240.1.
AL122003, AL133289 Genomic DNA. Translation: CAI22241.1.
AL133289, AL139342, AL122003 Genomic DNA. Translation: CAI22872.1.
AL133289, AL122003 Genomic DNA. Translation: CAI22873.1.
AL359819 Genomic DNA. No translation available.
BC008300 mRNA. Translation: AAH08300.2.
CCDSiCCDS44335.1. [A6NKB5-1]
RefSeqiNP_055616.3. NM_014801.3. [A6NKB5-1]
UniGeneiHs.370605.

Genome annotation databases

EnsembliENST00000258229; ENSP00000258229; ENSG00000135749. [A6NKB5-1]
ENST00000344698; ENSP00000340759; ENSG00000135749. [A6NKB5-3]
GeneIDi80003.
KEGGihsa:80003.
UCSCiuc001hvk.1. human. [A6NKB5-3]
uc001hvl.2. human. [A6NKB5-1]
uc001hvm.2. human. [A6NKB5-4]
uc001hvq.1. human. [A6NKB5-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007895 mRNA. Translation: BAA23708.2 . Different initiation.
AK074078 mRNA. Translation: BAB84904.1 . Different initiation.
AK021445 mRNA. Translation: BAB13826.1 .
AL139342 , AL122003 , AL133289 Genomic DNA. Translation: CAI18866.1 .
AL133291 Genomic DNA. No translation available.
AL133380 Genomic DNA. No translation available.
AL139342 Genomic DNA. Translation: CAI18867.1 .
AL122003 , AL139342 , AL133289 Genomic DNA. Translation: CAI22240.1 .
AL122003 , AL133289 Genomic DNA. Translation: CAI22241.1 .
AL133289 , AL139342 , AL122003 Genomic DNA. Translation: CAI22872.1 .
AL133289 , AL122003 Genomic DNA. Translation: CAI22873.1 .
AL359819 Genomic DNA. No translation available.
BC008300 mRNA. Translation: AAH08300.2 .
CCDSi CCDS44335.1. [A6NKB5-1 ]
RefSeqi NP_055616.3. NM_014801.3. [A6NKB5-1 ]
UniGenei Hs.370605.

3D structure databases

ProteinModelPortali A6NKB5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000258229.

PTM databases

PhosphoSitei A6NKB5.

Proteomic databases

PaxDbi A6NKB5.
PRIDEi A6NKB5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000258229 ; ENSP00000258229 ; ENSG00000135749 . [A6NKB5-1 ]
ENST00000344698 ; ENSP00000340759 ; ENSG00000135749 . [A6NKB5-3 ]
GeneIDi 80003.
KEGGi hsa:80003.
UCSCi uc001hvk.1. human. [A6NKB5-3 ]
uc001hvl.2. human. [A6NKB5-1 ]
uc001hvm.2. human. [A6NKB5-4 ]
uc001hvq.1. human. [A6NKB5-2 ]

Organism-specific databases

CTDi 80003.
GeneCardsi GC01M233119.
H-InvDB HIX0001704.
HGNCi HGNC:8736. PCNXL2.
HPAi HPA013815.
HPA014427.
neXtProti NX_A6NKB5.
PharmGKBi PA33081.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG297934.
GeneTreei ENSGT00390000013164.
HOVERGENi HBG108237.
InParanoidi A6NKB5.
OMAi MKDSVKD.
OrthoDBi EOG72VH54.
PhylomeDBi A6NKB5.
TreeFami TF313570.

Miscellaneous databases

ChiTaRSi PCNXL2. human.
GenomeRNAii 80003.
NextBioi 70075.
PROi A6NKB5.

Gene expression databases

Bgeei A6NKB5.
CleanExi HS_PCNXL2.
ExpressionAtlasi A6NKB5. baseline and differential.
Genevestigatori A6NKB5.

Family and domain databases

InterProi IPR007735. Pecanex.
[Graphical view ]
Pfami PF05041. Pecanex_C. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
    Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ASN-1901.
    Tissue: Brain.
  2. Ohara O.
    Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Spleen.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Embryo.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Colon.
  7. "Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability."
    Kim N.-G., Rhee H., Li L.S., Kim H., Lee J.-S., Kim J.-H., Kim N.K., Kim H.
    Oncogene 21:5081-5087(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. "Chromosomal imbalances in the colorectal carcinomas with microsatellite instability."
    Li L.S., Kim N.-G., Kim S.H., Park C., Kim H., Kang H.J., Koh K.H., Kim S.N., Kim W.H., Kim N.K., Kim H.
    Am. J. Pathol. 163:1429-1436(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiPCX2_HUMAN
AccessioniPrimary (citable) accession number: A6NKB5
Secondary accession number(s): O43162
, Q5T9Z8, Q5TDF1, Q8TEP4, Q96HP9, Q9HAL8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: October 29, 2014
This is version 60 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3