Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A6NKB5 (PCX2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 58. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pecanex-like protein 2
Gene names
Name:PCNXL2
Synonyms:KIAA0435
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2137 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H). Ref.7 Ref.8

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Miscellaneous

PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors.

Sequence similarities

Belongs to the pecanex family.

Sequence caution

The sequence BAA23708.2 differs from that shown. Reason: Erroneous initiation.

The sequence BAB84904.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A6NKB5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A6NKB5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-701: Missing.
     955-987: VFLYCFPAISLLGLFPQINTFCTYLLEQIDMLF → GKIMNSHKDFFTSEKKKDKIISAISSVIFLKSW
     988-2137: Missing.
Isoform 3 (identifier: A6NKB5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1348: Missing.
     1349-1359: RPVKFWEKNYN → MTFYPFVASSS
     2081-2137: HLSEPCEPPD...ASQQSVSDEQ → VRGWAGLTRT...PIPFSMGLPE
Note: No experimental confirmation available.
Isoform 5 (identifier: A6NKB5-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     1280-1288: LGDLLHKLQ → VFLGYVRQK
     1289-2137: Missing.
Isoform 4 (identifier: A6NKB5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1462: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 21372137Pecanex-like protein 2
PRO_0000333965

Regions

Transmembrane34 – 5421Helical; Potential
Transmembrane57 – 7721Helical; Potential
Transmembrane844 – 86421Helical; Potential
Transmembrane868 – 88821Helical; Potential
Transmembrane901 – 92121Helical; Potential
Transmembrane952 – 97221Helical; Potential
Transmembrane983 – 100321Helical; Potential
Transmembrane1029 – 104921Helical; Potential
Transmembrane1099 – 111921Helical; Potential
Transmembrane1124 – 114421Helical; Potential
Transmembrane1193 – 121321Helical; Potential
Transmembrane1237 – 125721Helical; Potential
Transmembrane1265 – 128521Helical; Potential
Transmembrane1302 – 132221Helical; Potential
Transmembrane1324 – 134421Helical; Potential
Compositional bias1937 – 2063127Ser-rich

Amino acid modifications

Glycosylation1361N-linked (GlcNAc...) Potential
Glycosylation4491N-linked (GlcNAc...) Potential
Glycosylation5501N-linked (GlcNAc...) Potential
Glycosylation5721N-linked (GlcNAc...) Potential
Glycosylation5871N-linked (GlcNAc...) Potential
Glycosylation5981N-linked (GlcNAc...) Potential
Glycosylation6131N-linked (GlcNAc...) Potential
Glycosylation14121N-linked (GlcNAc...) Potential
Glycosylation15531N-linked (GlcNAc...) Potential
Glycosylation18181N-linked (GlcNAc...) Potential
Glycosylation20541N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 14621462Missing in isoform 4.
VSP_033605
Alternative sequence1 – 13481348Missing in isoform 3.
VSP_033606
Alternative sequence1 – 867867Missing in isoform 5.
VSP_035048
Alternative sequence1 – 701701Missing in isoform 2.
VSP_033607
Alternative sequence955 – 98733VFLYC…IDMLF → GKIMNSHKDFFTSEKKKDKI ISAISSVIFLKSW in isoform 2.
VSP_033608
Alternative sequence988 – 21371150Missing in isoform 2.
VSP_033609
Alternative sequence1280 – 12889LGDLLHKLQ → VFLGYVRQK in isoform 5.
VSP_035049
Alternative sequence1289 – 2137849Missing in isoform 5.
VSP_035050
Alternative sequence1349 – 135911RPVKFWEKNYN → MTFYPFVASSS in isoform 3.
VSP_033610
Alternative sequence2081 – 213757HLSEP…VSDEQ → VRGWAGLTRTGWDGGTGSWP ERGTCLAFPPFCLQNPIPFS MGLPE in isoform 3.
VSP_033611
Natural variant1171R → K.
Corresponds to variant rs1033325 [ dbSNP | Ensembl ].
VAR_050479
Natural variant4541T → A.
Corresponds to variant rs10910120 [ dbSNP | Ensembl ].
VAR_043341
Natural variant19011S → N. Ref.1
Corresponds to variant rs56231757 [ dbSNP | Ensembl ].
VAR_061498
Natural variant19841R → Q.
Corresponds to variant rs41309639 [ dbSNP | Ensembl ].
VAR_061499

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 20, 2008. Version 3.
Checksum: 064D91B62BF84E44

FASTA2,137237,277
        10         20         30         40         50         60 
MVSQVLQLLR QGVWAALTGG WYHDPEQSKF TNSCHLYLWL FLLLLPLALH LAFPPNAIIV 

        70         80         90        100        110        120 
FFYCSAVTIF FTIIKLVSYR LHLMFDKGEV IQQKPSRKEE KPNKDKEAKG EHITNHRNPS 

       130        140        150        160        170        180 
NNRQIHNGKK EEASRNLSTP PLRCSSRGQS ITSHHSSGPL ELSAQETVED LKGVILLEDH 

       190        200        210        220        230        240 
PIAPVSSTSP GIKVESLPAS QAHMLETTTK SVIPVKPVAT ETLINGKGKE RGGKGQPPLR 

       250        260        270        280        290        300 
HRSEGGLVDK GPLKKLPHLS LSQYDLLETD VSFQPWGSEN SVLIPEPVSC PRGSIRERVQ 

       310        320        330        340        350        360 
SKSPQDSLSS SCPQCDTIVA KPVEEPADTS CQVDTSCQGD LPLHQEVDSS DSEVAVTLID 

       370        380        390        400        410        420 
TSQPGDPLSL HEPIKIVITM SSTPNSMTDL ESSLHLRVVG TEKTSVKSDA EPTNPGAAGS 

       430        440        450        460        470        480 
PNAEQISIPV ITLDLPEGGG GGVPCPEGNG SERTPERLKT RVSTNQCSGY GSGEGGNAIK 

       490        500        510        520        530        540 
DHSSSSREPW ESVSRLTPDT GSESKVGKEG QTNLDPSSCK SSHEKRHARV LSVDSGTDVF 

       550        560        570        580        590        600 
LSKSSAEIVN DTEKTMPTSK SDLEAKEGQM PNESNFLEFV SLLESINTSK MTASSQLNGS 

       610        620        630        640        650        660 
AEQNEESGLL RDNCSQEKKE EILENEKPSG HSSKQGKPDL QSQDHTSTGP ACTQPAKTTA 

       670        680        690        700        710        720 
FFQGNRQRQI IYRVTSQQDS SVLQVISGPE TSVQEEISVD AMHVFIDEHG EIRSCYLKSG 

       730        740        750        760        770        780 
NQKEGPLQPL PSNNDCLSQA REMQVSSSST TTSESQDPSS GDPAVSALQQ QLLLMVARRT 

       790        800        810        820        830        840 
QSETPRHVSQ DLEASSCSST QGKFNREQFY KFIIFPGKWI KVWYDRLTLL ALLDRTEDIK 

       850        860        870        880        890        900 
ENVLAILLIV LVSLLGFLTL SQGFCKDMWV LLFCLVMASC QYSLLKSVQP DPASPIHGHN 

       910        920        930        940        950        960 
QIITYSRPIY FCVLCGLILL LDTGAKARHP PSYVVYGLKL FSPVFLQSAR DYLIVFLYCF 

       970        980        990       1000       1010       1020 
PAISLLGLFP QINTFCTYLL EQIDMLFFGG SAVSGITSAV YSVARSVLAA ALLHAVCFSA 

      1030       1040       1050       1060       1070       1080 
VKEPWSMQHI PALFSAFCGL LVALSYHLSR QSSDPSVLMS FIQCRLFPKF LHQNLAESAA 

      1090       1100       1110       1120       1130       1140 
DPLPKKMKDS VTDVLKWDLI VCAVVAVLSF AVSASTVFLS LRPFLSIVLF ALAGAVGFVT 

      1150       1160       1170       1180       1190       1200 
HYVLPQLRKH HPWMWISHPI LKNKEYHQRE VRDVAHLMWF ERLYVWLQCF EKYILYPALI 

      1210       1220       1230       1240       1250       1260 
LNALTIDAFL ISNHRRLGTH WDIFLMIIAG MKLLRTSFCN PVYQFINLSF TVIFFHFDYK 

      1270       1280       1290       1300       1310       1320 
DISESFLLDF FMVSILFSKL GDLLHKLQFV LTYVAPWQMA WGSSFHVFAQ LFAIPHSAML 

      1330       1340       1350       1360       1370       1380 
FFQTIATSIF STPLSPFLGS VIFITSYVRP VKFWEKNYNT RRVDNSNTRL AVQIERDPGN 

      1390       1400       1410       1420       1430       1440 
DDNNLNSIFY EHLTRTLQES LCGDLVLGRW GNYSSGDCFI LASDDLNAFV HLIEIGNGLV 

      1450       1460       1470       1480       1490       1500 
TFQLRGLEFR GTYCQQREVE AIMEGDEEDR GCCCCKPGHL PHLLSCNAAF HLRWLTWEIT 

      1510       1520       1530       1540       1550       1560 
QTQYILEGYS ILDNNAATML QVFDLRRILI RYYIKSIIYY MVTSPKLLSW IKNESLLKSL 

      1570       1580       1590       1600       1610       1620 
QPFAKWHYIE RDLAMFNINI DDDYVPCLQG ITRASFCNVY LEWIQHCARK RQEPSTTLDS 

      1630       1640       1650       1660       1670       1680 
DEDSPLVTLS FALCTLGRRA LGTAAHNMAI SLDSFLYGLH VLFKGDFRIT ARDEWVFADM 

      1690       1700       1710       1720       1730       1740 
DLLHKVVAPA IRMSLKLHQD QFTCPDEYED PAVLYEAIQS FEKKVVICHE GDPAWRGAVL 

      1750       1760       1770       1780       1790       1800 
SNKEELLTLR HVVDEGADEY KVIMLHRSFL SFKVIKVNKE CVRGLWAGQQ QELIFLRNRN 

      1810       1820       1830       1840       1850       1860 
PERGSIQNNK QVLRNLINSS CDQPLGYPMY VSPLTTSYLG THRQLKNIWG GPITLDRIRT 

      1870       1880       1890       1900       1910       1920 
WFWTKWVRMR KDCNARQHSG GNIEDVDGGG APTTGGNNAP SGGSQESSAE QPRKGGAQHG 

      1930       1940       1950       1960       1970       1980 
VSSCEGTQRT GRRKGRSQSV QAHSALSQRP PMLSSSGPIL ESRQTFLQTS TSVHELAQRL 

      1990       2000       2010       2020       2030       2040 
SGSRLSLHAS ATSLHSQPPP VTTTGHLSVR ERAEALIRSS LGSSTSSTLS FLFGKRSFSS 

      2050       2060       2070       2080       2090       2100 
ALVISGLSAA EGGNTSDTQS SSSVNIVMGP SARAASQATR HLSEPCEPPD ATEQGQLHDR 

      2110       2120       2130 
CLAEAVADTL GVVCRRASQE DMGLDDTASQ QSVSDEQ 

« Hide

Isoform 2 [UniParc].

Checksum: 6C2E4681ED159F22
Show »

FASTA28632,206
Isoform 3 [UniParc].

Checksum: 35E12F71B1BCE69E
Show »

FASTA77786,628
Isoform 5 [UniParc].

Checksum: D6C30F9210A8A1C8
Show »

FASTA42148,009
Isoform 4 [UniParc].

Checksum: 80B564005A8ED96E
Show »

FASTA67575,024

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro."
Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 4:307-313(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ASN-1901.
Tissue: Brain.
[2]Ohara O.
Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[3]"The nucleotide sequence of a long cDNA clone isolated from human spleen."
Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Spleen.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Embryo.
[5]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Tissue: Colon.
[7]"Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability."
Kim N.-G., Rhee H., Li L.S., Kim H., Lee J.-S., Kim J.-H., Kim N.K., Kim H.
Oncogene 21:5081-5087(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[8]"Chromosomal imbalances in the colorectal carcinomas with microsatellite instability."
Li L.S., Kim N.-G., Kim S.H., Park C., Kim H., Kang H.J., Koh K.H., Kim S.N., Kim W.H., Kim N.K., Kim H.
Am. J. Pathol. 163:1429-1436(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB007895 mRNA. Translation: BAA23708.2. Different initiation.
AK074078 mRNA. Translation: BAB84904.1. Different initiation.
AK021445 mRNA. Translation: BAB13826.1.
AL139342, AL122003, AL133289 Genomic DNA. Translation: CAI18866.1.
AL133291 Genomic DNA. No translation available.
AL133380 Genomic DNA. No translation available.
AL139342 Genomic DNA. Translation: CAI18867.1.
AL122003, AL139342, AL133289 Genomic DNA. Translation: CAI22240.1.
AL122003, AL133289 Genomic DNA. Translation: CAI22241.1.
AL133289, AL139342, AL122003 Genomic DNA. Translation: CAI22872.1.
AL133289, AL122003 Genomic DNA. Translation: CAI22873.1.
AL359819 Genomic DNA. No translation available.
BC008300 mRNA. Translation: AAH08300.2.
CCDSCCDS44335.1. [A6NKB5-1]
RefSeqNP_055616.3. NM_014801.3. [A6NKB5-1]
UniGeneHs.370605.

3D structure databases

ProteinModelPortalA6NKB5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000258229.

PTM databases

PhosphoSiteA6NKB5.

Proteomic databases

PaxDbA6NKB5.
PRIDEA6NKB5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000258229; ENSP00000258229; ENSG00000135749. [A6NKB5-1]
ENST00000344698; ENSP00000340759; ENSG00000135749. [A6NKB5-3]
ENST00000430153; ENSP00000394703; ENSG00000135749. [A6NKB5-2]
GeneID80003.
KEGGhsa:80003.
UCSCuc001hvk.1. human. [A6NKB5-3]
uc001hvl.2. human. [A6NKB5-1]
uc001hvm.2. human. [A6NKB5-4]
uc001hvq.1. human. [A6NKB5-2]

Organism-specific databases

CTD80003.
GeneCardsGC01M233119.
H-InvDBHIX0001704.
HGNCHGNC:8736. PCNXL2.
HPAHPA013815.
HPA014427.
neXtProtNX_A6NKB5.
PharmGKBPA33081.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG297934.
HOVERGENHBG108237.
InParanoidA6NKB5.
OMAMKDSVKD.
OrthoDBEOG72VH54.
PhylomeDBA6NKB5.
TreeFamTF313570.

Gene expression databases

ArrayExpressA6NKB5.
BgeeA6NKB5.
CleanExHS_PCNXL2.
GenevestigatorA6NKB5.

Family and domain databases

InterProIPR007735. Pecanex.
[Graphical view]
PfamPF05041. Pecanex_C. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPCNXL2. human.
GenomeRNAi80003.
NextBio70075.
PROA6NKB5.

Entry information

Entry namePCX2_HUMAN
AccessionPrimary (citable) accession number: A6NKB5
Secondary accession number(s): O43162 expand/collapse secondary AC list , Q5T9Z8, Q5TDF1, Q8TEP4, Q96HP9, Q9HAL8
Entry history
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: July 9, 2014
This is version 58 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM