A6NHL2 (TBAL3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 62.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tubulin alpha chain-like 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 446 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Sequence similarities | Belongs to the tubulin family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton Microtubule |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | GTP-binding Nucleotide-binding |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | microtubule-based process Inferred from electronic annotation. Source: InterPro protein polymerizationInferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW microtubuleInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTPase activityInferred from electronic annotation. Source: InterPro structural constituent of cytoskeletonInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A6NHL2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A6NHL2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQ → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 446 | 446 | Tubulin alpha chain-like 3 | PRO_0000313709 | |||||
Regions | |||||||||
| Nucleotide binding | 149 – 155 | 7 | GTP Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 41 | 41 | MRECL…LDTQQ → M in isoform 2. | VSP_030108 | |||||
| Natural variant | 135 | 1 | Q → H. Corresponds to variant rs11818372 [ dbSNP | Ensembl ]. | VAR_037706 | |||||
| Natural variant | 250 | 1 | R → W. Corresponds to variant rs34080891 [ dbSNP | Ensembl ]. | VAR_037707 | |||||
Experimental info | |||||||||
| Sequence conflict | 128 | 1 | R → G in BAG59224. Ref.1 | ||||||
| Sequence conflict | 134 | 1 | E → K in EAW86447. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK025318 mRNA. Translation: BAB15110.1. AK296616 mRNA. Translation: BAG59224.1. AL683826 Genomic DNA. Translation: CAI23625.1. CH471072 Genomic DNA. Translation: EAW86447.1. BC098247 mRNA. Translation: AAH98247.1. BC099716 mRNA. Translation: AAH99716.1. BC105634 mRNA. Translation: AAI05635.1. |
| IPI | IPI00015671. IPI00879904. |
| RefSeq | NP_001165335.1. NM_001171864.1. NP_079079.1. NM_024803.2. |
| UniGene | Hs.163079. |
3D structure databases | |
| ProteinModelPortal | A6NHL2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | A6NHL2. 2 interactions. |
| STRING | 9606.ENSP00000369784. |
Proteomic databases | |
| PaxDb | A6NHL2. |
| PRIDE | A6NHL2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000380419; ENSP00000369784; ENSG00000178462. ENST00000479328; ENSP00000418799; ENSG00000178462. ENST00000581892; ENSP00000463918; ENSG00000263440. ENST00000582002; ENSP00000464037; ENSG00000263440. |
| GeneID | 79861. |
| KEGG | hsa:79861. |
| UCSC | uc001ihy.3. human. uc001ihz.3. human. |
Organism-specific databases | |
| CTD | 79861. |
| GeneCards | GC10M005425. |
| HGNC | HGNC:23534. TUBAL3. |
| HPA | HPA045900. |
| neXtProt | NX_A6NHL2. |
| PharmGKB | PA134953102. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5023. |
| HOGENOM | HOG000165711. |
| HOVERGEN | HBG000089. |
| InParanoid | A6NHL2. |
| KO | K07374. |
| OMA | RGRYSVG. |
| OrthoDB | EOG44F693. |
Gene expression databases | |
| Bgee | A6NHL2. |
| CleanEx | HS_TUBAL3. |
| Genevestigator | A6NHL2. |
Family and domain databases | |
| Gene3D | 1.10.287.600. 1 hit. 3.30.1330.20. 1 hit. 3.40.50.1440. 1 hit. |
| InterPro | IPR002452. Alpha_tubulin. IPR008280. Tub_FtsZ_C. IPR000217. Tubulin. IPR018316. Tubulin/FtsZ_2-layer-sand-dom. IPR023123. Tubulin_C. IPR017975. Tubulin_CS. IPR003008. Tubulin_FtsZ_GTPase. [Graphical view] |
| PANTHER | PTHR11588. PTHR11588. 1 hit. |
| Pfam | PF00091. Tubulin. 1 hit. PF03953. Tubulin_C. 1 hit. [Graphical view] |
| PRINTS | PR01162. ALPHATUBULIN. PR01161. TUBULIN. |
| SMART | SM00864. Tubulin. 1 hit. SM00865. Tubulin_C. 1 hit. [Graphical view] |
| SUPFAM | SSF55307. Tub_FtsZ_C. 1 hit. SSF52490. Tubulin_FtsZ. 1 hit. |
| PROSITE | PS00227. TUBULIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79861. |
| NextBio | 69592. |
Entry information
| Entry name | TBAL3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A6NHL2 Secondary accession number(s): B4DKL2, Q4QQJ5, Q9H6Z0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
