Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin alpha chain-like 3

Gene

TUBAL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi149 – 155GTPSequence analysis7

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-1445148 Translocation of GLUT4 to the plasma membrane
R-HSA-190840 Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane
R-HSA-190861 Gap junction assembly
R-HSA-2132295 MHC class II antigen presentation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-389960 Formation of tubulin folding intermediates by CCT/TriC
R-HSA-389977 Post-chaperonin tubulin folding pathway
R-HSA-437239 Recycling pathway of L1
R-HSA-5617833 Cilium Assembly
R-HSA-5626467 RHO GTPases activate IQGAPs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-68877 Mitotic Prometaphase
R-HSA-8852276 The role of GTSE1 in G2/M progression after G2 checkpoint
R-HSA-8955332 Carboxyterminal post-translational modifications of tubulin
R-HSA-983189 Kinesins

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin alpha chain-like 3
Gene namesi
Name:TUBAL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000178462.11
HGNCiHGNC:23534 TUBAL3
neXtProtiNX_A6NHL2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000178462
PharmGKBiPA134953102

Chemistry databases

ChEMBLiCHEMBL3832941

Polymorphism and mutation databases

BioMutaiTUBAL3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003137091 – 446Tubulin alpha chain-like 3Add BLAST446

Post-translational modificationi

Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group. Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold.By similarity
Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear.By similarity

Proteomic databases

MaxQBiA6NHL2
PaxDbiA6NHL2
PRIDEiA6NHL2

PTM databases

iPTMnetiA6NHL2
PhosphoSitePlusiA6NHL2

Expressioni

Gene expression databases

BgeeiENSG00000178462
CleanExiHS_TUBAL3
GenevisibleiA6NHL2 HS

Organism-specific databases

HPAiHPA045900
HPA063394

Interactioni

Subunit structurei

Dimer of alpha and beta chains. A typical microtubule is a hollow water-filled tube with an outer diameter of 25 nm and an inner diameter of 15 nM. Alpha-beta heterodimers associate head-to-tail to form protofilaments running lengthwise along the microtubule wall with the beta-tubulin subunit facing the microtubule plus end conferring a structural polarity. Microtubules usually have 13 protofilaments but different protofilament numbers can be found in some organisms and specialized cells.

Protein-protein interaction databases

BioGridi122949, 15 interactors
IntActiA6NHL2, 6 interactors
STRINGi9606.ENSP00000369784

Structurei

3D structure databases

ProteinModelPortaliA6NHL2
SMRiA6NHL2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the tubulin family.Curated

Phylogenomic databases

eggNOGiKOG1376 Eukaryota
COG5023 LUCA
GeneTreeiENSGT00760000119060
HOGENOMiHOG000165711
HOVERGENiHBG000089
InParanoidiA6NHL2
KOiK07374
OMAiTFFCETR
OrthoDBiEOG091G093N
PhylomeDBiA6NHL2
TreeFamiTF300314

Family and domain databases

Gene3Di1.10.287.600, 1 hit
3.30.1330.20, 1 hit
3.40.50.1440, 1 hit
InterProiView protein in InterPro
IPR002452 Alpha_tubulin
IPR008280 Tub_FtsZ_C
IPR000217 Tubulin
IPR018316 Tubulin/FtsZ_2-layer-sand-dom
IPR037103 Tubulin/FtsZ_C_sf
IPR036525 Tubulin/FtsZ_GTPase_sf
IPR023123 Tubulin_C
IPR017975 Tubulin_CS
IPR003008 Tubulin_FtsZ_GTPase
PANTHERiPTHR11588 PTHR11588, 1 hit
PfamiView protein in Pfam
PF00091 Tubulin, 1 hit
PF03953 Tubulin_C, 1 hit
PRINTSiPR01162 ALPHATUBULIN
PR01161 TUBULIN
SMARTiView protein in SMART
SM00864 Tubulin, 1 hit
SM00865 Tubulin_C, 1 hit
SUPFAMiSSF52490 SSF52490, 1 hit
SSF55307 SSF55307, 1 hit
PROSITEiView protein in PROSITE
PS00227 TUBULIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6NHL2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRECLSIHIG QAGIQIGDAC WELYCLEHGI QPNGVVLDTQ QDQLENAKME
60 70 80 90 100
HTNASFDTFF CETRAGKHVP RALFVDLEPT VIDGIRTGQH RSLFHPEQLL
110 120 130 140 150
SGKEDAANNY ARGRYSVGSE VIDLVLERTR KLAEQCGGLQ GFLIFRSFGG
160 170 180 190 200
GTGSGFTSLL MERLTGEYSR KTKLEFSVYP APRISTAVVE PYNSVLTTHS
210 220 230 240 250
TTEHTDCTFM VDNEAVYDIC HRKLGVECPS HASINRLVVQ VVSSITASLR
260 270 280 290 300
FEGPLNVDLI EFQTNLVPYP RIHFPMTAFA PIVSADKAYH EQFSVSDITT
310 320 330 340 350
ACFESSNQLV KCDPRLGKYM ACCLLYRGDV VPKEVNAAIA ATKSRHSVQF
360 370 380 390 400
VDWCPTGFKV GINNRPPTVM PGGDLAKVHR SICMLSNTTA IVEAWARLDH
410 420 430 440
KFDLMYAKRA FLHWYLREGM EEAEFLEARE DLAALERDYE EVAQSF
Length:446
Mass (Da):49,909
Last modified:January 15, 2008 - v2
Checksum:iD826240ACC90B6EC
GO
Isoform 2 (identifier: A6NHL2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQ → M

Show »
Length:406
Mass (Da):45,518
Checksum:i461A205AAD34DB4C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti128R → G in BAG59224 (PubMed:14702039).Curated1
Sequence conflicti134E → K in EAW86447 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037706135Q → H. Corresponds to variant dbSNP:rs11818372Ensembl.1
Natural variantiVAR_037707250R → W. Corresponds to variant dbSNP:rs34080891Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0301081 – 41MRECL…LDTQQ → M in isoform 2. 2 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025318 mRNA Translation: BAB15110.1
AK296616 mRNA Translation: BAG59224.1
AL683826 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86447.1
BC098247 mRNA Translation: AAH98247.1
BC099716 mRNA Translation: AAH99716.1
BC105634 mRNA Translation: AAI05635.1
CCDSiCCDS53491.1 [A6NHL2-2]
CCDS7066.2 [A6NHL2-1]
RefSeqiNP_001165335.1, NM_001171864.1 [A6NHL2-2]
NP_079079.1, NM_024803.2 [A6NHL2-1]
UniGeneiHs.163079

Genome annotation databases

EnsembliENST00000380419; ENSP00000369784; ENSG00000178462 [A6NHL2-1]
ENST00000479328; ENSP00000418799; ENSG00000178462 [A6NHL2-2]
GeneIDi79861
KEGGihsa:79861
UCSCiuc001ihy.3 human [A6NHL2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTBAL3_HUMAN
AccessioniPrimary (citable) accession number: A6NHL2
Secondary accession number(s): B4DKL2, Q4QQJ5, Q9H6Z0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: April 25, 2018
This is version 105 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health