A6NDY0 (EPAB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 54.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Embryonic polyadenylate-binding protein 2 Short name=Embryonic poly(A)-binding protein 2 Short name=ePABP-2 Short name=ePABP2 Alternative name(s): Embryonic poly(A)-binding protein type II Poly(A)-binding protein nuclear-like 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 278 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Binds the poly(A) tail of mRNA By similarity. |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Expressed in various adult tissues. Ref.1 |
| Sequence similarities | Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | RNA-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A6NDY0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A6NDY0-2) The sequence of this isoform differs from the canonical sequence as follows: 190-190: Y → CCRKEPTSLGSAPQTAGAFEDTQAPGGHPSPTAASRAGPGSDHKGRTGPVENSHHGFHRIKGKTRF 191-278: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: A6NDY0-4) The sequence of this isoform differs from the canonical sequence as follows: 267-278: ARGKFSPWFSPY → TPAALTPLWARPLPWVVVSHVIK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: A6NDY0-3) The sequence of this isoform differs from the canonical sequence as follows: 154-154: V → LCLHRVCHQG...RSKPLVLHPG 155-278: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 278 | 278 | Embryonic polyadenylate-binding protein 2 | PRO_0000349172 | |||||
Regions | |||||||||
| Domain | 147 – 224 | 78 | RRM | ||||||
Natural variations | |||||||||
| Alternative sequence | 154 | 1 | V → LCLHRVCHQGLRAGRRGAGP EPLPGPGHQGAAEKNQLPWD QLHRPRGPSRTPRLQGGTLP PQRPPGQAPAQTTRAEPGPW KILTMVFTVLKGRPDFERGA GAWIRSKPLVLHPG in isoform 3. | VSP_035211 | |||||
| Alternative sequence | 155 – 278 | 124 | Missing in isoform 3. | VSP_035212 | |||||
| Alternative sequence | 190 | 1 | Y → CCRKEPTSLGSAPQTAGAFE DTQAPGGHPSPTAASRAGPG SDHKGRTGPVENSHHGFHRI KGKTRF in isoform 2. | VSP_035213 | |||||
| Alternative sequence | 191 – 278 | 88 | Missing in isoform 2. | VSP_035214 | |||||
| Alternative sequence | 267 – 278 | 12 | ARGKF…WFSPY → TPAALTPLWARPLPWVVVSH VIK in isoform 4. | VSP_040501 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns." Sakugawa N., Miyamoto T., Sato H., Ishikawa M., Horikawa M., Hayashi H., Ishikawa M., Sengoku K. J. Assist. Reprod. Genet. 25:215-221(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Ovary. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC092384 Genomic DNA. No translation available. BC130001 mRNA. Translation: AAI30002.1. BC130002 mRNA. Translation: AAI30003.1. |
| IPI | IPI00375983. IPI00854628. IPI00942797. IPI01021917. |
| RefSeq | NP_001073956.2. NM_001080487.2. |
| UniGene | Hs.730522. |
3D structure databases | |
| ProteinModelPortal | A6NDY0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000367609. |
PTM databases | |
| PhosphoSite | A6NDY0. |
Proteomic databases | |
| PaxDb | A6NDY0. |
| PRIDE | A6NDY0. |
Protocols and materials databases | |
| DNASU | 390748. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378358; ENSP00000367609; ENSG00000205022. ENST00000411789; ENSP00000405259; ENSG00000205022. ENST00000419291; ENSP00000408598; ENSG00000205022. ENST00000547152; ENSP00000449247; ENSG00000205022. |
| GeneID | 390748. |
| KEGG | hsa:390748. |
| UCSC | uc002fmi.3. human. uc010vpd.2. human. uc010vpe.2. human. |
Organism-specific databases | |
| CTD | 390748. |
| GeneCards | GC16M088928. |
| H-InvDB | HIX0059621. |
| HGNC | HGNC:37237. PABPN1L. |
| HPA | HPA043415. |
| neXtProt | NX_A6NDY0. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0724. |
| HOGENOM | HOG000208465. |
| HOVERGEN | HBG107480. |
| InParanoid | A6NDY0. |
| KO | K14396. |
| OMA | RCGEVHR. |
Gene expression databases | |
| ArrayExpress | A6NDY0. |
| Bgee | A6NDY0. |
| Genevestigator | A6NDY0. |
Family and domain databases | |
| Gene3D | 3.30.70.330. 1 hit. |
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] |
| Pfam | PF00076. RRM_1. 1 hit. [Graphical view] |
| SMART | SM00360. RRM. 1 hit. [Graphical view] |
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 390748. |
| NextBio | 104019. |
Entry information
| Entry name | EPAB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A6NDY0 Secondary accession number(s): A1L3B3, A2VDI2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
