Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A6NDY0

- EPAB2_HUMAN

UniProt

A6NDY0 - EPAB2_HUMAN

Protein

Embryonic polyadenylate-binding protein 2

Gene

PABPN1L

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 65 (01 Oct 2014)
      Sequence version 1 (24 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds the poly(A) tail of mRNA.By similarity

    GO - Molecular functioni

    1. nucleotide binding Source: InterPro
    2. RNA binding Source: UniProtKB-KW

    Keywords - Ligandi

    RNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Embryonic polyadenylate-binding protein 2
    Short name:
    Embryonic poly(A)-binding protein 2
    Short name:
    ePABP-2
    Short name:
    ePABP2
    Alternative name(s):
    Embryonic poly(A)-binding protein type II
    Poly(A)-binding protein nuclear-like 1
    Gene namesi
    Name:PABPN1L
    Synonyms:EPABP2, PABPNL1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:37237. PABPN1L.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 278278Embryonic polyadenylate-binding protein 2PRO_0000349172Add
    BLAST

    Proteomic databases

    MaxQBiA6NDY0.
    PaxDbiA6NDY0.
    PRIDEiA6NDY0.

    PTM databases

    PhosphoSiteiA6NDY0.

    Expressioni

    Tissue specificityi

    Expressed in various adult tissues.1 Publication

    Gene expression databases

    BgeeiA6NDY0.
    GenevestigatoriA6NDY0.

    Organism-specific databases

    HPAiHPA043415.

    Interactioni

    Protein-protein interaction databases

    BioGridi133674. 1 interaction.
    STRINGi9606.ENSP00000367609.

    Structurei

    3D structure databases

    ProteinModelPortaliA6NDY0.
    SMRiA6NDY0. Positions 142-228.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini147 – 22478RRMPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0724.
    HOGENOMiHOG000208465.
    HOVERGENiHBG107480.
    InParanoidiA6NDY0.
    KOiK14396.
    OMAiRCGEVHR.
    OrthoDBiEOG7K9K3Z.
    PhylomeDBiA6NDY0.
    TreeFamiTF105907.

    Family and domain databases

    Gene3Di3.30.70.330. 1 hit.
    InterProiIPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view]
    PfamiPF00076. RRM_1. 1 hit.
    [Graphical view]
    SMARTiSM00360. RRM. 1 hit.
    [Graphical view]
    PROSITEiPS50102. RRM. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A6NDY0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWPFPSRSLF PPPTQAWLQT VSSDPEAQGW GAWNETKEIL GPEGGEGKEE    50
    KEEEEDAEED QDGDAGFLLS LLEQENLAEC PLPDQELEAI KMKVCAMEQA 100
    EGTPRPPGVQ QQAEEEEGTA AGQLLSPETV GCPLSGTPEE KVEADHRSVY 150
    VGNVDYGGSA EELEAHFSRC GEVHRVTILC DKFSGHPKGY AYIEFATKGS 200
    VQAAVELDQS LFRGRVIKVL PKRTNFPGIS STDRGGLRGH PGSRGAPFPH 250
    SGLQGRPRLR PQGQNRARGK FSPWFSPY 278
    Length:278
    Mass (Da):30,386
    Last modified:July 24, 2007 - v1
    Checksum:i4662DAB7022CACD5
    GO
    Isoform 2 (identifier: A6NDY0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         190-190: Y → CCRKEPTSLGSAPQTAGAFEDTQAPGGHPSPTAASRAGPGSDHKGRTGPVENSHHGFHRIKGKTRF
         191-278: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:255
    Mass (Da):27,382
    Checksum:iCFB6377FA13689F8
    GO
    Isoform 4 (identifier: A6NDY0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         267-278: ARGKFSPWFSPY → TPAALTPLWARPLPWVVVSHVIK

    Note: No experimental confirmation available.

    Show »
    Length:289
    Mass (Da):31,495
    Checksum:iB7B2FE2E6A478128
    GO
    Isoform 3 (identifier: A6NDY0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         154-154: V → LCLHRVCHQG...RSKPLVLHPG
         155-278: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:267
    Mass (Da):29,017
    Checksum:i481820E362076EB9
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei154 – 1541V → LCLHRVCHQGLRAGRRGAGP EPLPGPGHQGAAEKNQLPWD QLHRPRGPSRTPRLQGGTLP PQRPPGQAPAQTTRAEPGPW KILTMVFTVLKGRPDFERGA GAWIRSKPLVLHPG in isoform 3. 1 PublicationVSP_035211
    Alternative sequencei155 – 278124Missing in isoform 3. 1 PublicationVSP_035212Add
    BLAST
    Alternative sequencei190 – 1901Y → CCRKEPTSLGSAPQTAGAFE DTQAPGGHPSPTAASRAGPG SDHKGRTGPVENSHHGFHRI KGKTRF in isoform 2. 1 PublicationVSP_035213
    Alternative sequencei191 – 27888Missing in isoform 2. 1 PublicationVSP_035214Add
    BLAST
    Alternative sequencei267 – 27812ARGKF…WFSPY → TPAALTPLWARPLPWVVVSH VIK in isoform 4. CuratedVSP_040501Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC092384 Genomic DNA. No translation available.
    BC130001 mRNA. Translation: AAI30002.1.
    BC130002 mRNA. Translation: AAI30003.1.
    CCDSiCCDS45547.2. [A6NDY0-1]
    RefSeqiNP_001073956.2. NM_001080487.2. [A6NDY0-1]
    XP_005256368.1. XM_005256311.1. [A6NDY0-2]
    UniGeneiHs.730522.

    Genome annotation databases

    EnsembliENST00000411789; ENSP00000405259; ENSG00000205022. [A6NDY0-2]
    ENST00000419291; ENSP00000408598; ENSG00000205022. [A6NDY0-1]
    GeneIDi390748.
    KEGGihsa:390748.
    UCSCiuc002fmi.3. human. [A6NDY0-2]
    uc010vpe.2. human. [A6NDY0-1]
    uc031qxi.1. human. [A6NDY0-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC092384 Genomic DNA. No translation available.
    BC130001 mRNA. Translation: AAI30002.1 .
    BC130002 mRNA. Translation: AAI30003.1 .
    CCDSi CCDS45547.2. [A6NDY0-1 ]
    RefSeqi NP_001073956.2. NM_001080487.2. [A6NDY0-1 ]
    XP_005256368.1. XM_005256311.1. [A6NDY0-2 ]
    UniGenei Hs.730522.

    3D structure databases

    ProteinModelPortali A6NDY0.
    SMRi A6NDY0. Positions 142-228.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 133674. 1 interaction.
    STRINGi 9606.ENSP00000367609.

    PTM databases

    PhosphoSitei A6NDY0.

    Proteomic databases

    MaxQBi A6NDY0.
    PaxDbi A6NDY0.
    PRIDEi A6NDY0.

    Protocols and materials databases

    DNASUi 390748.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000411789 ; ENSP00000405259 ; ENSG00000205022 . [A6NDY0-2 ]
    ENST00000419291 ; ENSP00000408598 ; ENSG00000205022 . [A6NDY0-1 ]
    GeneIDi 390748.
    KEGGi hsa:390748.
    UCSCi uc002fmi.3. human. [A6NDY0-2 ]
    uc010vpe.2. human. [A6NDY0-1 ]
    uc031qxi.1. human. [A6NDY0-4 ]

    Organism-specific databases

    CTDi 390748.
    GeneCardsi GC16M088928.
    H-InvDB HIX0059621.
    HGNCi HGNC:37237. PABPN1L.
    HPAi HPA043415.
    neXtProti NX_A6NDY0.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0724.
    HOGENOMi HOG000208465.
    HOVERGENi HBG107480.
    InParanoidi A6NDY0.
    KOi K14396.
    OMAi RCGEVHR.
    OrthoDBi EOG7K9K3Z.
    PhylomeDBi A6NDY0.
    TreeFami TF105907.

    Miscellaneous databases

    GenomeRNAii 390748.
    NextBioi 104019.
    PROi A6NDY0.

    Gene expression databases

    Bgeei A6NDY0.
    Genevestigatori A6NDY0.

    Family and domain databases

    Gene3Di 3.30.70.330. 1 hit.
    InterProi IPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view ]
    Pfami PF00076. RRM_1. 1 hit.
    [Graphical view ]
    SMARTi SM00360. RRM. 1 hit.
    [Graphical view ]
    PROSITEi PS50102. RRM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns."
      Sakugawa N., Miyamoto T., Sato H., Ishikawa M., Horikawa M., Hayashi H., Ishikawa M., Sengoku K.
      J. Assist. Reprod. Genet. 25:215-221(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Ovary.
    2. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).

    Entry informationi

    Entry nameiEPAB2_HUMAN
    AccessioniPrimary (citable) accession number: A6NDY0
    Secondary accession number(s): A1L3B3, A2VDI2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 2, 2008
    Last sequence update: July 24, 2007
    Last modified: October 1, 2014
    This is version 65 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3