Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A6NDY0 (EPAB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 62. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Embryonic polyadenylate-binding protein 2

Short name=Embryonic poly(A)-binding protein 2
Short name=ePABP-2
Short name=ePABP2
Alternative name(s):
Embryonic poly(A)-binding protein type II
Poly(A)-binding protein nuclear-like 1
Gene names
Name:PABPN1L
Synonyms:EPABP2, PABPNL1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length278 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Binds the poly(A) tail of mRNA By similarity.

Subcellular location

Cytoplasm By similarity.

Tissue specificity

Expressed in various adult tissues. Ref.1

Sequence similarities

Contains 1 RRM (RNA recognition motif) domain.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   LigandRNA-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionRNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

nucleotide binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A6NDY0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A6NDY0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     190-190: Y → CCRKEPTSLGSAPQTAGAFEDTQAPGGHPSPTAASRAGPGSDHKGRTGPVENSHHGFHRIKGKTRF
     191-278: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: A6NDY0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     267-278: ARGKFSPWFSPY → TPAALTPLWARPLPWVVVSHVIK
Note: No experimental confirmation available.
Isoform 3 (identifier: A6NDY0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: V → LCLHRVCHQG...RSKPLVLHPG
     155-278: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 278278Embryonic polyadenylate-binding protein 2
PRO_0000349172

Regions

Domain147 – 22478RRM

Natural variations

Alternative sequence1541V → LCLHRVCHQGLRAGRRGAGP EPLPGPGHQGAAEKNQLPWD QLHRPRGPSRTPRLQGGTLP PQRPPGQAPAQTTRAEPGPW KILTMVFTVLKGRPDFERGA GAWIRSKPLVLHPG in isoform 3.
VSP_035211
Alternative sequence155 – 278124Missing in isoform 3.
VSP_035212
Alternative sequence1901Y → CCRKEPTSLGSAPQTAGAFE DTQAPGGHPSPTAASRAGPG SDHKGRTGPVENSHHGFHRI KGKTRF in isoform 2.
VSP_035213
Alternative sequence191 – 27888Missing in isoform 2.
VSP_035214
Alternative sequence267 – 27812ARGKF…WFSPY → TPAALTPLWARPLPWVVVSH VIK in isoform 4.
VSP_040501

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 24, 2007. Version 1.
Checksum: 4662DAB7022CACD5

FASTA27830,386
        10         20         30         40         50         60 
MWPFPSRSLF PPPTQAWLQT VSSDPEAQGW GAWNETKEIL GPEGGEGKEE KEEEEDAEED 

        70         80         90        100        110        120 
QDGDAGFLLS LLEQENLAEC PLPDQELEAI KMKVCAMEQA EGTPRPPGVQ QQAEEEEGTA 

       130        140        150        160        170        180 
AGQLLSPETV GCPLSGTPEE KVEADHRSVY VGNVDYGGSA EELEAHFSRC GEVHRVTILC 

       190        200        210        220        230        240 
DKFSGHPKGY AYIEFATKGS VQAAVELDQS LFRGRVIKVL PKRTNFPGIS STDRGGLRGH 

       250        260        270 
PGSRGAPFPH SGLQGRPRLR PQGQNRARGK FSPWFSPY 

« Hide

Isoform 2 [UniParc].

Checksum: CFB6377FA13689F8
Show »

FASTA25527,382
Isoform 4 [UniParc].

Checksum: B7B2FE2E6A478128
Show »

FASTA28931,495
Isoform 3 [UniParc].

Checksum: 481820E362076EB9
Show »

FASTA26729,017

References

« Hide 'large scale' references
[1]"Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns."
Sakugawa N., Miyamoto T., Sato H., Ishikawa M., Horikawa M., Hayashi H., Ishikawa M., Sengoku K.
J. Assist. Reprod. Genet. 25:215-221(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Ovary.
[2]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC092384 Genomic DNA. No translation available.
BC130001 mRNA. Translation: AAI30002.1.
BC130002 mRNA. Translation: AAI30003.1.
RefSeqNP_001073956.2. NM_001080487.2.
XP_005256368.1. XM_005256311.1.
UniGeneHs.730522.

3D structure databases

ProteinModelPortalA6NDY0.
SMRA6NDY0. Positions 142-228.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid133674. 1 interaction.
STRING9606.ENSP00000367609.

PTM databases

PhosphoSiteA6NDY0.

Proteomic databases

PaxDbA6NDY0.
PRIDEA6NDY0.

Protocols and materials databases

DNASU390748.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000378358; ENSP00000367609; ENSG00000205022. [A6NDY0-4]
ENST00000411789; ENSP00000405259; ENSG00000205022. [A6NDY0-2]
ENST00000419291; ENSP00000408598; ENSG00000205022. [A6NDY0-1]
ENST00000547152; ENSP00000449247; ENSG00000205022. [A6NDY0-3]
GeneID390748.
KEGGhsa:390748.
UCSCuc002fmi.3. human. [A6NDY0-2]
uc010vpe.2. human. [A6NDY0-1]
uc031qxi.1. human. [A6NDY0-4]

Organism-specific databases

CTD390748.
GeneCardsGC16M088928.
H-InvDBHIX0059621.
HGNCHGNC:37237. PABPN1L.
HPAHPA043415.
neXtProtNX_A6NDY0.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0724.
HOGENOMHOG000208465.
HOVERGENHBG107480.
InParanoidA6NDY0.
KOK14396.
OMAWPFLSHA.
OrthoDBEOG7K9K3Z.
PhylomeDBA6NDY0.
TreeFamTF105907.

Gene expression databases

BgeeA6NDY0.
GenevestigatorA6NDY0.

Family and domain databases

Gene3D3.30.70.330. 1 hit.
InterProIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTSM00360. RRM. 1 hit.
[Graphical view]
PROSITEPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi390748.
NextBio104019.
PROA6NDY0.

Entry information

Entry nameEPAB2_HUMAN
AccessionPrimary (citable) accession number: A6NDY0
Secondary accession number(s): A1L3B3, A2VDI2
Entry history
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 24, 2007
Last modified: April 16, 2014
This is version 62 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM