Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Embryonic polyadenylate-binding protein 2

Gene

PABPN1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Binds the poly(A) tail of mRNA.By similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Embryonic polyadenylate-binding protein 2
Short name:
Embryonic poly(A)-binding protein 2
Short name:
ePABP-2
Short name:
ePABP2
Alternative name(s):
Embryonic poly(A)-binding protein type II
Poly(A)-binding protein nuclear-like 1
Gene namesi
Name:PABPN1L
Synonyms:EPABP2, PABPNL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:37237. PABPN1L.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiPABPN1L.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 278278Embryonic polyadenylate-binding protein 2PRO_0000349172Add
BLAST

Proteomic databases

MaxQBiA6NDY0.
PaxDbiA6NDY0.
PRIDEiA6NDY0.

PTM databases

PhosphoSiteiA6NDY0.

Expressioni

Tissue specificityi

Expressed in various adult tissues.1 Publication

Gene expression databases

BgeeiA6NDY0.
GenevestigatoriA6NDY0.

Organism-specific databases

HPAiHPA043415.

Interactioni

Protein-protein interaction databases

BioGridi133674. 1 interaction.
STRINGi9606.ENSP00000367609.

Structurei

3D structure databases

ProteinModelPortaliA6NDY0.
SMRiA6NDY0. Positions 86-228.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini147 – 22478RRMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0724.
GeneTreeiENSGT00390000001517.
HOGENOMiHOG000208465.
HOVERGENiHBG107480.
InParanoidiA6NDY0.
KOiK14396.
OMAiRCGEVHR.
OrthoDBiEOG7K9K3Z.
PhylomeDBiA6NDY0.
TreeFamiTF105907.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6NDY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWPFPSRSLF PPPTQAWLQT VSSDPEAQGW GAWNETKEIL GPEGGEGKEE
60 70 80 90 100
KEEEEDAEED QDGDAGFLLS LLEQENLAEC PLPDQELEAI KMKVCAMEQA
110 120 130 140 150
EGTPRPPGVQ QQAEEEEGTA AGQLLSPETV GCPLSGTPEE KVEADHRSVY
160 170 180 190 200
VGNVDYGGSA EELEAHFSRC GEVHRVTILC DKFSGHPKGY AYIEFATKGS
210 220 230 240 250
VQAAVELDQS LFRGRVIKVL PKRTNFPGIS STDRGGLRGH PGSRGAPFPH
260 270
SGLQGRPRLR PQGQNRARGK FSPWFSPY
Length:278
Mass (Da):30,386
Last modified:July 24, 2007 - v1
Checksum:i4662DAB7022CACD5
GO
Isoform 2 (identifier: A6NDY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     190-190: Y → CCRKEPTSLGSAPQTAGAFEDTQAPGGHPSPTAASRAGPGSDHKGRTGPVENSHHGFHRIKGKTRF
     191-278: Missing.

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):27,382
Checksum:iCFB6377FA13689F8
GO
Isoform 4 (identifier: A6NDY0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-278: ARGKFSPWFSPY → TPAALTPLWARPLPWVVVSHVIK

Note: No experimental confirmation available.

Show »
Length:289
Mass (Da):31,495
Checksum:iB7B2FE2E6A478128
GO
Isoform 3 (identifier: A6NDY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: V → LCLHRVCHQG...RSKPLVLHPG
     155-278: Missing.

Note: No experimental confirmation available.

Show »
Length:267
Mass (Da):29,017
Checksum:i481820E362076EB9
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei154 – 1541V → LCLHRVCHQGLRAGRRGAGP EPLPGPGHQGAAEKNQLPWD QLHRPRGPSRTPRLQGGTLP PQRPPGQAPAQTTRAEPGPW KILTMVFTVLKGRPDFERGA GAWIRSKPLVLHPG in isoform 3. 1 PublicationVSP_035211
Alternative sequencei155 – 278124Missing in isoform 3. 1 PublicationVSP_035212Add
BLAST
Alternative sequencei190 – 1901Y → CCRKEPTSLGSAPQTAGAFE DTQAPGGHPSPTAASRAGPG SDHKGRTGPVENSHHGFHRI KGKTRF in isoform 2. 1 PublicationVSP_035213
Alternative sequencei191 – 27888Missing in isoform 2. 1 PublicationVSP_035214Add
BLAST
Alternative sequencei267 – 27812ARGKF…WFSPY → TPAALTPLWARPLPWVVVSH VIK in isoform 4. CuratedVSP_040501Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC092384 Genomic DNA. No translation available.
BC130001 mRNA. Translation: AAI30002.1.
BC130002 mRNA. Translation: AAI30003.1.
CCDSiCCDS45547.2. [A6NDY0-1]
CCDS73925.1. [A6NDY0-2]
RefSeqiNP_001073956.2. NM_001080487.2. [A6NDY0-1]
NP_001281257.1. NM_001294328.1. [A6NDY0-2]
UniGeneiHs.730522.

Genome annotation databases

EnsembliENST00000411789; ENSP00000405259; ENSG00000205022. [A6NDY0-2]
ENST00000419291; ENSP00000408598; ENSG00000205022. [A6NDY0-1]
ENST00000547152; ENSP00000449247; ENSG00000205022. [A6NDY0-3]
GeneIDi390748.
KEGGihsa:390748.
UCSCiuc002fmi.3. human. [A6NDY0-2]
uc010vpe.2. human. [A6NDY0-1]
uc031qxi.1. human. [A6NDY0-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC092384 Genomic DNA. No translation available.
BC130001 mRNA. Translation: AAI30002.1.
BC130002 mRNA. Translation: AAI30003.1.
CCDSiCCDS45547.2. [A6NDY0-1]
CCDS73925.1. [A6NDY0-2]
RefSeqiNP_001073956.2. NM_001080487.2. [A6NDY0-1]
NP_001281257.1. NM_001294328.1. [A6NDY0-2]
UniGeneiHs.730522.

3D structure databases

ProteinModelPortaliA6NDY0.
SMRiA6NDY0. Positions 86-228.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi133674. 1 interaction.
STRINGi9606.ENSP00000367609.

PTM databases

PhosphoSiteiA6NDY0.

Polymorphism and mutation databases

BioMutaiPABPN1L.

Proteomic databases

MaxQBiA6NDY0.
PaxDbiA6NDY0.
PRIDEiA6NDY0.

Protocols and materials databases

DNASUi390748.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000411789; ENSP00000405259; ENSG00000205022. [A6NDY0-2]
ENST00000419291; ENSP00000408598; ENSG00000205022. [A6NDY0-1]
ENST00000547152; ENSP00000449247; ENSG00000205022. [A6NDY0-3]
GeneIDi390748.
KEGGihsa:390748.
UCSCiuc002fmi.3. human. [A6NDY0-2]
uc010vpe.2. human. [A6NDY0-1]
uc031qxi.1. human. [A6NDY0-4]

Organism-specific databases

CTDi390748.
GeneCardsiGC16M088928.
H-InvDBHIX0059621.
HGNCiHGNC:37237. PABPN1L.
HPAiHPA043415.
neXtProtiNX_A6NDY0.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0724.
GeneTreeiENSGT00390000001517.
HOGENOMiHOG000208465.
HOVERGENiHBG107480.
InParanoidiA6NDY0.
KOiK14396.
OMAiRCGEVHR.
OrthoDBiEOG7K9K3Z.
PhylomeDBiA6NDY0.
TreeFamiTF105907.

Miscellaneous databases

GenomeRNAii390748.
NextBioi104019.
PROiA6NDY0.

Gene expression databases

BgeeiA6NDY0.
GenevestigatoriA6NDY0.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns."
    Sakugawa N., Miyamoto T., Sato H., Ishikawa M., Horikawa M., Hayashi H., Ishikawa M., Sengoku K.
    J. Assist. Reprod. Genet. 25:215-221(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Ovary.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).

Entry informationi

Entry nameiEPAB2_HUMAN
AccessioniPrimary (citable) accession number: A6NDY0
Secondary accession number(s): A1L3B3, A2VDI2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 24, 2007
Last modified: May 27, 2015
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.