Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative L-aspartate dehydrogenase

Gene

ASPDH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.By similarity

Miscellaneous

The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia.By similarity

Catalytic activityi

L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H.

Pathwayi: NAD(+) biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes iminoaspartate from L-aspartate (dehydrogenase route).
Proteins known to be involved in this subpathway in this organism are:
  1. Putative L-aspartate dehydrogenase (ASPDH)
This subpathway is part of the pathway NAD(+) biosynthesis, which is itself part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes iminoaspartate from L-aspartate (dehydrogenase route), the pathway NAD(+) biosynthesis and in Cofactor biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei127NAD; via amide nitrogenBy similarity1
Binding sitei192NADBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
Biological processPyridine nucleotide biosynthesis
LigandNAD, NADP

Enzyme and pathway databases

UniPathwayiUPA00253; UER00456

Names & Taxonomyi

Protein namesi
Recommended name:
Putative L-aspartate dehydrogenase (EC:1.4.1.21)
Alternative name(s):
Aspartate dehydrogenase domain-containing protein
Gene namesi
Name:ASPDH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000204653.9
HGNCiHGNC:33856 ASPDH
neXtProtiNX_A6ND91

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000204653
PharmGKBiPA164716234

Polymorphism and mutation databases

BioMutaiASPDH

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003006231 – 283Putative L-aspartate dehydrogenaseAdd BLAST283

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei20PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiA6ND91
PRIDEiA6ND91

PTM databases

iPTMnetiA6ND91
PhosphoSitePlusiA6ND91

Expressioni

Gene expression databases

BgeeiENSG00000204653
ExpressionAtlasiA6ND91 baseline and differential
GenevisibleiA6ND91 HS

Organism-specific databases

HPAiHPA042631
HPA042654

Interactioni

Protein-protein interaction databases

BioGridi299841, 9 interactors
IntActiA6ND91, 1 interactor
MINTiA6ND91
STRINGi9606.ENSP00000373860

Structurei

3D structure databases

ProteinModelPortaliA6ND91
SMRiA6ND91
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the L-aspartate dehydrogenase family.Curated

Phylogenomic databases

eggNOGiENOG410IKT3 Eukaryota
ENOG410Y5EZ LUCA
GeneTreeiENSGT00390000004452
HOGENOMiHOG000007399
HOVERGENiHBG062283
InParanoidiA6ND91
KOiK06989
OMAiHTHRENP
OrthoDBiEOG091G0G7I
PhylomeDBiA6ND91
TreeFamiTF315092

Family and domain databases

InterProiView protein in InterPro
IPR005106 Asp/hSer_DH_NAD-bd
IPR002811 Asp_DH
IPR011182 L-Asp_DH
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF01958 DUF108, 1 hit
PF03447 NAD_binding_3, 1 hit
PIRSFiPIRSF005227 Asp_dh_NAD_syn, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6ND91-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADRGPWRVG VVGYGRLGQS LVSRLLAQGP ELGLELVFVW NRDPGRMAGS
60 70 80 90 100
VPPSLQLQNL AALGERRPDL VVEVAHPKII HESGAQILRH ANLLVGSPSA
110 120 130 140 150
LSDQTTERQL LEASQHWDHA VFVARGALWG AEDIRRLDAA GGLRSLRVTM
160 170 180 190 200
ATHPDGFRLE GPLAAAHSPG PCTVLYEGPV RGLCPFAPRN SNTMAAAALA
210 220 230 240 250
APSLGFDGVI GVLVADTSLT DMHVVDVELS GPRGPTGRSF AVHTRRENPA
260 270 280
EPGAVTGSAT VTAFWQSLLA CCQLPSRPGI HLC
Length:283
Mass (Da):29,946
Last modified:September 11, 2007 - v2
Checksum:iFF4254EF3F14D840
GO
Isoform 2 (identifier: A6ND91-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS
     95-144: Missing.

Show »
Length:178
Mass (Da):18,655
Checksum:i132E8AE73F175366
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_062676266Q → R2 PublicationsCorresponds to variant dbSNP:rs12977172Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387422 – 65ADRGP…AALGE → GDRVKGSKS in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_03874395 – 144Missing in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471135 Genomic DNA Translation: EAW71880.1
AC008743 Genomic DNA No translation available.
BC066359 mRNA Translation: AAH66359.1
CCDSiCCDS33082.1 [A6ND91-2]
CCDS46153.1 [A6ND91-1]
RefSeqiNP_001019827.2, NM_001024656.2 [A6ND91-2]
NP_001108070.1, NM_001114598.1 [A6ND91-1]
UniGeneiHs.436338

Genome annotation databases

EnsembliENST00000376916; ENSP00000366114; ENSG00000204653 [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653 [A6ND91-1]
GeneIDi554235
KEGGihsa:554235
UCSCiuc002psr.4 human [A6ND91-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiASPD_HUMAN
AccessioniPrimary (citable) accession number: A6ND91
Secondary accession number(s): Q6NZ37
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: April 25, 2018
This is version 94 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health