Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A6ND91

- ASPD_HUMAN

UniProt

A6ND91 - ASPD_HUMAN

Protein

Putative L-aspartate dehydrogenase

Gene

ASPDH

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 67 (01 Oct 2014)
      Sequence version 2 (11 Sep 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.By similarity

    Catalytic activityi

    L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei127 – 1271NAD; via amide nitrogenBy similarity
    Binding sitei192 – 1921NADBy similarity

    GO - Molecular functioni

    1. aspartate dehydrogenase activity Source: UniProtKB-EC
    2. NADP binding Source: InterPro

    GO - Biological processi

    1. NAD biosynthetic process Source: UniProtKB-UniPathway
    2. NADP catabolic process Source: InterPro

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Pyridine nucleotide biosynthesis

    Keywords - Ligandi

    NAD, NADP

    Enzyme and pathway databases

    UniPathwayiUPA00253; UER00456.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Putative L-aspartate dehydrogenase (EC:1.4.1.21)
    Alternative name(s):
    Aspartate dehydrogenase domain-containing protein
    Gene namesi
    Name:ASPDH
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:33856. ASPDH.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164716234.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 283283Putative L-aspartate dehydrogenasePRO_0000300623Add
    BLAST

    Proteomic databases

    PaxDbiA6ND91.
    PRIDEiA6ND91.

    PTM databases

    PhosphoSiteiA6ND91.

    Expressioni

    Gene expression databases

    ArrayExpressiA6ND91.
    BgeeiA6ND91.
    GenevestigatoriA6ND91.

    Organism-specific databases

    HPAiHPA042631.
    HPA042654.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000373860.

    Structurei

    3D structure databases

    ProteinModelPortaliA6ND91.
    SMRiA6ND91. Positions 9-227.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the L-aspartate dehydrogenase family.Curated

    Phylogenomic databases

    eggNOGiNOG73354.
    HOGENOMiHOG000007399.
    HOVERGENiHBG062283.
    InParanoidiA6ND91.
    OMAiLAFVWNR.
    PhylomeDBiA6ND91.
    TreeFamiTF315092.

    Family and domain databases

    Gene3Di3.40.50.720. 1 hit.
    InterProiIPR005106. Asp/hSer_DH_NAD-bd.
    IPR002811. Asp_DH.
    IPR011182. L-Asp_DH.
    IPR016040. NAD(P)-bd_dom.
    [Graphical view]
    PfamiPF01958. DUF108. 1 hit.
    PF03447. NAD_binding_3. 1 hit.
    [Graphical view]
    PIRSFiPIRSF005227. Asp_dh_NAD_syn. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A6ND91-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MADRGPWRVG VVGYGRLGQS LVSRLLAQGP ELGLELVFVW NRDPGRMAGS    50
    VPPSLQLQNL AALGERRPDL VVEVAHPKII HESGAQILRH ANLLVGSPSA 100
    LSDQTTERQL LEASQHWDHA VFVARGALWG AEDIRRLDAA GGLRSLRVTM 150
    ATHPDGFRLE GPLAAAHSPG PCTVLYEGPV RGLCPFAPRN SNTMAAAALA 200
    APSLGFDGVI GVLVADTSLT DMHVVDVELS GPRGPTGRSF AVHTRRENPA 250
    EPGAVTGSAT VTAFWQSLLA CCQLPSRPGI HLC 283
    Length:283
    Mass (Da):29,946
    Last modified:September 11, 2007 - v2
    Checksum:iFF4254EF3F14D840
    GO
    Isoform 2 (identifier: A6ND91-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS
         95-144: Missing.

    Show »
    Length:178
    Mass (Da):18,655
    Checksum:i132E8AE73F175366
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti266 – 2661Q → R.2 Publications
    Corresponds to variant rs12977172 [ dbSNP | Ensembl ].
    VAR_062676

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 6564ADRGP…AALGE → GDRVKGSKS in isoform 2. 1 PublicationVSP_038742Add
    BLAST
    Alternative sequencei95 – 14450Missing in isoform 2. 1 PublicationVSP_038743Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    CH471135 Genomic DNA. Translation: EAW71880.1.
    AC008743 Genomic DNA. No translation available.
    BC066359 mRNA. Translation: AAH66359.1.
    CCDSiCCDS33082.1. [A6ND91-2]
    CCDS46153.1. [A6ND91-1]
    RefSeqiNP_001019827.2. NM_001024656.2. [A6ND91-2]
    NP_001108070.1. NM_001114598.1. [A6ND91-1]
    UniGeneiHs.436338.

    Genome annotation databases

    EnsembliENST00000376916; ENSP00000366114; ENSG00000204653. [A6ND91-2]
    ENST00000389208; ENSP00000373860; ENSG00000204653. [A6ND91-1]
    GeneIDi554235.
    KEGGihsa:554235.
    UCSCiuc002psr.4. human. [A6ND91-2]
    uc010enz.3. human. [A6ND91-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    CH471135 Genomic DNA. Translation: EAW71880.1 .
    AC008743 Genomic DNA. No translation available.
    BC066359 mRNA. Translation: AAH66359.1 .
    CCDSi CCDS33082.1. [A6ND91-2 ]
    CCDS46153.1. [A6ND91-1 ]
    RefSeqi NP_001019827.2. NM_001024656.2. [A6ND91-2 ]
    NP_001108070.1. NM_001114598.1. [A6ND91-1 ]
    UniGenei Hs.436338.

    3D structure databases

    ProteinModelPortali A6ND91.
    SMRi A6ND91. Positions 9-227.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000373860.

    PTM databases

    PhosphoSitei A6ND91.

    Proteomic databases

    PaxDbi A6ND91.
    PRIDEi A6ND91.

    Protocols and materials databases

    DNASUi 554235.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000376916 ; ENSP00000366114 ; ENSG00000204653 . [A6ND91-2 ]
    ENST00000389208 ; ENSP00000373860 ; ENSG00000204653 . [A6ND91-1 ]
    GeneIDi 554235.
    KEGGi hsa:554235.
    UCSCi uc002psr.4. human. [A6ND91-2 ]
    uc010enz.3. human. [A6ND91-1 ]

    Organism-specific databases

    CTDi 554235.
    GeneCardsi GC19M051014.
    HGNCi HGNC:33856. ASPDH.
    HPAi HPA042631.
    HPA042654.
    neXtProti NX_A6ND91.
    PharmGKBi PA164716234.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG73354.
    HOGENOMi HOG000007399.
    HOVERGENi HBG062283.
    InParanoidi A6ND91.
    OMAi LAFVWNR.
    PhylomeDBi A6ND91.
    TreeFami TF315092.

    Enzyme and pathway databases

    UniPathwayi UPA00253 ; UER00456 .

    Miscellaneous databases

    NextBioi 112458.
    PROi A6ND91.

    Gene expression databases

    ArrayExpressi A6ND91.
    Bgeei A6ND91.
    Genevestigatori A6ND91.

    Family and domain databases

    Gene3Di 3.40.50.720. 1 hit.
    InterProi IPR005106. Asp/hSer_DH_NAD-bd.
    IPR002811. Asp_DH.
    IPR011182. L-Asp_DH.
    IPR016040. NAD(P)-bd_dom.
    [Graphical view ]
    Pfami PF01958. DUF108. 1 hit.
    PF03447. NAD_binding_3. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF005227. Asp_dh_NAD_syn. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-266.
    2. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-266.
      Tissue: Brain.

    Entry informationi

    Entry nameiASPD_HUMAN
    AccessioniPrimary (citable) accession number: A6ND91
    Secondary accession number(s): Q6NZ37
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: September 11, 2007
    Last modified: October 1, 2014
    This is version 67 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia.By similarity

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3