A6ND91 (ASPD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 55.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative L-aspartate dehydrogenase EC=1.4.1.21 Alternative name(s): Aspartate dehydrogenase domain-containing protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 283 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate By similarity. |
| Catalytic activity | L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H. |
| Pathway | |
| Miscellaneous | The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia By similarity. |
| Sequence similarities | Belongs to the L-aspartate dehydrogenase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Pyridine nucleotide biosynthesis |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | NAD NADP |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | NAD biosynthetic process Inferred from electronic annotation. Source: UniProtKB-UniPathway NADP catabolic processInferred from electronic annotation. Source: InterPro |
| Molecular_function | NADP binding Inferred from electronic annotation. Source: InterPro aspartate dehydrogenase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A6ND91-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A6ND91-2) The sequence of this isoform differs from the canonical sequence as follows: 2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS 95-144: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 283 | 283 | Putative L-aspartate dehydrogenase | PRO_0000300623 | |||||
Sites | |||||||||
| Binding site | 127 | 1 | NAD; via amide nitrogen By similarity | ||||||
| Binding site | 192 | 1 | NAD By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 2 – 65 | 64 | ADRGP…AALGE → GDRVKGSKS in isoform 2. | VSP_038742 | |||||
| Alternative sequence | 95 – 144 | 50 | Missing in isoform 2. | VSP_038743 | |||||
| Natural variant | 266 | 1 | Q → R. Ref.1 Ref.3 Corresponds to variant rs12977172 [ dbSNP | Ensembl ]. | VAR_062676 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-266. |
| [2] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-266. Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | CH471135 Genomic DNA. Translation: EAW71880.1. AC008743 Genomic DNA. No translation available. BC066359 mRNA. Translation: AAH66359.1. |
| IPI | IPI00419903. IPI00783370. |
| RefSeq | NP_001019827.2. NM_001024656.2. NP_001108070.1. NM_001114598.1. |
| UniGene | Hs.436338. |
3D structure databases | |
| ProteinModelPortal | A6ND91. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000373860. |
PTM databases | |
| PhosphoSite | A6ND91. |
Proteomic databases | |
| PaxDb | A6ND91. |
| PRIDE | A6ND91. |
Protocols and materials databases | |
| DNASU | 554235. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000376916; ENSP00000366114; ENSG00000204653. ENST00000389208; ENSP00000373860; ENSG00000204653. |
| GeneID | 554235. |
| KEGG | hsa:554235. |
| UCSC | uc002psr.4. human. uc010enz.3. human. |
Organism-specific databases | |
| CTD | 554235. |
| GeneCards | GC19M051014. |
| HGNC | HGNC:33856. ASPDH. |
| HPA | HPA042631. HPA042654. |
| neXtProt | NX_A6ND91. |
| PharmGKB | PA164716234. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG73354. |
| HOGENOM | HOG000007399. |
| HOVERGEN | HBG062283. |
| InParanoid | A6ND91. |
| OMA | LAFVWNR. |
Enzyme and pathway databases | |
| UniPathway | UPA00253; UER00456. |
Gene expression databases | |
| Bgee | A6ND91. |
| Genevestigator | A6ND91. |
Family and domain databases | |
| Gene3D | 3.40.50.720. 1 hit. |
| InterPro | IPR005106. Asp/hSer_DH_NAD-bd. IPR002811. Asp_DH. IPR011182. Asp_DH_NAD_syn. IPR016040. NAD(P)-bd_dom. [Graphical view] |
| Pfam | PF01958. DUF108. 1 hit. PF03447. NAD_binding_3. 1 hit. [Graphical view] |
| PIRSF | PIRSF005227. Asp_dh_NAD_syn. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 112458. |
Entry information
| Entry name | ASPD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A6ND91 Secondary accession number(s): Q6NZ37 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
