Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A6ND91 (ASPD_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 65. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Putative L-aspartate dehydrogenase

EC=1.4.1.21
Alternative name(s):
Aspartate dehydrogenase domain-containing protein
Gene names
Name:ASPDH
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length283 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate By similarity.

Catalytic activity

L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H.

Pathway

Cofactor biosynthesis; NAD(+) biosynthesis; iminoaspartate from L-aspartate (dehydrogenase route): step 1/1.

Miscellaneous

The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia By similarity.

Sequence similarities

Belongs to the L-aspartate dehydrogenase family.

Ontologies

Keywords
   Biological processPyridine nucleotide biosynthesis
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandNAD
NADP
   Molecular functionOxidoreductase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processNAD biosynthetic process

Inferred from electronic annotation. Source: UniProtKB-UniPathway

NADP catabolic process

Inferred from electronic annotation. Source: InterPro

   Molecular_functionNADP binding

Inferred from electronic annotation. Source: InterPro

aspartate dehydrogenase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A6ND91-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A6ND91-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS
     95-144: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 283283Putative L-aspartate dehydrogenase
PRO_0000300623

Sites

Binding site1271NAD; via amide nitrogen By similarity
Binding site1921NAD By similarity

Natural variations

Alternative sequence2 – 6564ADRGP…AALGE → GDRVKGSKS in isoform 2.
VSP_038742
Alternative sequence95 – 14450Missing in isoform 2.
VSP_038743
Natural variant2661Q → R. Ref.1 Ref.3
Corresponds to variant rs12977172 [ dbSNP | Ensembl ].
VAR_062676

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 11, 2007. Version 2.
Checksum: FF4254EF3F14D840

FASTA28329,946
        10         20         30         40         50         60 
MADRGPWRVG VVGYGRLGQS LVSRLLAQGP ELGLELVFVW NRDPGRMAGS VPPSLQLQNL 

        70         80         90        100        110        120 
AALGERRPDL VVEVAHPKII HESGAQILRH ANLLVGSPSA LSDQTTERQL LEASQHWDHA 

       130        140        150        160        170        180 
VFVARGALWG AEDIRRLDAA GGLRSLRVTM ATHPDGFRLE GPLAAAHSPG PCTVLYEGPV 

       190        200        210        220        230        240 
RGLCPFAPRN SNTMAAAALA APSLGFDGVI GVLVADTSLT DMHVVDVELS GPRGPTGRSF 

       250        260        270        280 
AVHTRRENPA EPGAVTGSAT VTAFWQSLLA CCQLPSRPGI HLC 

« Hide

Isoform 2 [UniParc].

Checksum: 132E8AE73F175366
Show »

FASTA17818,655

References

[1]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-266.
[2]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-266.
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
CH471135 Genomic DNA. Translation: EAW71880.1.
AC008743 Genomic DNA. No translation available.
BC066359 mRNA. Translation: AAH66359.1.
CCDSCCDS33082.1. [A6ND91-2]
CCDS46153.1. [A6ND91-1]
RefSeqNP_001019827.2. NM_001024656.2. [A6ND91-2]
NP_001108070.1. NM_001114598.1. [A6ND91-1]
UniGeneHs.436338.

3D structure databases

ProteinModelPortalA6ND91.
SMRA6ND91. Positions 9-227.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000373860.

PTM databases

PhosphoSiteA6ND91.

Proteomic databases

PaxDbA6ND91.
PRIDEA6ND91.

Protocols and materials databases

DNASU554235.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000376916; ENSP00000366114; ENSG00000204653. [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653. [A6ND91-1]
GeneID554235.
KEGGhsa:554235.
UCSCuc002psr.4. human. [A6ND91-2]
uc010enz.3. human. [A6ND91-1]

Organism-specific databases

CTD554235.
GeneCardsGC19M051014.
HGNCHGNC:33856. ASPDH.
HPAHPA042631.
HPA042654.
neXtProtNX_A6ND91.
PharmGKBPA164716234.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG73354.
HOGENOMHOG000007399.
HOVERGENHBG062283.
InParanoidA6ND91.
OMALAFVWNR.
PhylomeDBA6ND91.
TreeFamTF315092.

Enzyme and pathway databases

UniPathwayUPA00253; UER00456.

Gene expression databases

ArrayExpressA6ND91.
BgeeA6ND91.
GenevestigatorA6ND91.

Family and domain databases

Gene3D3.40.50.720. 1 hit.
InterProIPR005106. Asp/hSer_DH_NAD-bd.
IPR002811. Asp_DH.
IPR011182. Asp_DH_NAD_syn.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamPF01958. DUF108. 1 hit.
PF03447. NAD_binding_3. 1 hit.
[Graphical view]
PIRSFPIRSF005227. Asp_dh_NAD_syn. 1 hit.
ProtoNetSearch...

Other

NextBio112458.
PROA6ND91.

Entry information

Entry nameASPD_HUMAN
AccessionPrimary (citable) accession number: A6ND91
Secondary accession number(s): Q6NZ37
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: July 9, 2014
This is version 65 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM