Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative L-aspartate dehydrogenase

Gene

ASPDH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.By similarity

Catalytic activityi

L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei127 – 1271NAD; via amide nitrogenBy similarity
Binding sitei192 – 1921NADBy similarity

GO - Molecular functioni

  1. aspartate dehydrogenase activity Source: UniProtKB-EC
  2. NADP binding Source: InterPro

GO - Biological processi

  1. NAD biosynthetic process Source: UniProtKB-UniPathway
  2. NADP catabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Pyridine nucleotide biosynthesis

Keywords - Ligandi

NAD, NADP

Enzyme and pathway databases

UniPathwayiUPA00253; UER00456.

Names & Taxonomyi

Protein namesi
Recommended name:
Putative L-aspartate dehydrogenase (EC:1.4.1.21)
Alternative name(s):
Aspartate dehydrogenase domain-containing protein
Gene namesi
Name:ASPDH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:33856. ASPDH.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164716234.

Polymorphism and mutation databases

BioMutaiASPDH.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 283283Putative L-aspartate dehydrogenasePRO_0000300623Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei20 – 201Phosphoserine1 Publication
Modified residuei168 – 1681Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiA6ND91.
PRIDEiA6ND91.

PTM databases

PhosphoSiteiA6ND91.

Expressioni

Gene expression databases

BgeeiA6ND91.
ExpressionAtlasiA6ND91. baseline and differential.
GenevestigatoriA6ND91.

Organism-specific databases

HPAiHPA042631.
HPA042654.

Interactioni

Protein-protein interaction databases

BioGridi299841. 2 interactions.
STRINGi9606.ENSP00000373860.

Structurei

3D structure databases

ProteinModelPortaliA6ND91.
SMRiA6ND91. Positions 8-227.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the L-aspartate dehydrogenase family.Curated

Phylogenomic databases

eggNOGiNOG73354.
GeneTreeiENSGT00390000004452.
HOGENOMiHOG000007399.
HOVERGENiHBG062283.
InParanoidiA6ND91.
OMAiLELVFVW.
PhylomeDBiA6ND91.
TreeFamiTF315092.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
InterProiIPR005106. Asp/hSer_DH_NAD-bd.
IPR002811. Asp_DH.
IPR011182. L-Asp_DH.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamiPF01958. DUF108. 1 hit.
PF03447. NAD_binding_3. 1 hit.
[Graphical view]
PIRSFiPIRSF005227. Asp_dh_NAD_syn. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6ND91-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADRGPWRVG VVGYGRLGQS LVSRLLAQGP ELGLELVFVW NRDPGRMAGS
60 70 80 90 100
VPPSLQLQNL AALGERRPDL VVEVAHPKII HESGAQILRH ANLLVGSPSA
110 120 130 140 150
LSDQTTERQL LEASQHWDHA VFVARGALWG AEDIRRLDAA GGLRSLRVTM
160 170 180 190 200
ATHPDGFRLE GPLAAAHSPG PCTVLYEGPV RGLCPFAPRN SNTMAAAALA
210 220 230 240 250
APSLGFDGVI GVLVADTSLT DMHVVDVELS GPRGPTGRSF AVHTRRENPA
260 270 280
EPGAVTGSAT VTAFWQSLLA CCQLPSRPGI HLC
Length:283
Mass (Da):29,946
Last modified:September 11, 2007 - v2
Checksum:iFF4254EF3F14D840
GO
Isoform 2 (identifier: A6ND91-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS
     95-144: Missing.

Show »
Length:178
Mass (Da):18,655
Checksum:i132E8AE73F175366
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti266 – 2661Q → R.2 Publications
Corresponds to variant rs12977172 [ dbSNP | Ensembl ].
VAR_062676

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 6564ADRGP…AALGE → GDRVKGSKS in isoform 2. 1 PublicationVSP_038742Add
BLAST
Alternative sequencei95 – 14450Missing in isoform 2. 1 PublicationVSP_038743Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471135 Genomic DNA. Translation: EAW71880.1.
AC008743 Genomic DNA. No translation available.
BC066359 mRNA. Translation: AAH66359.1.
CCDSiCCDS33082.1. [A6ND91-2]
CCDS46153.1. [A6ND91-1]
RefSeqiNP_001019827.2. NM_001024656.2. [A6ND91-2]
NP_001108070.1. NM_001114598.1. [A6ND91-1]
UniGeneiHs.436338.

Genome annotation databases

EnsembliENST00000376916; ENSP00000366114; ENSG00000204653. [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653. [A6ND91-1]
GeneIDi554235.
KEGGihsa:554235.
UCSCiuc002psr.4. human. [A6ND91-2]
uc010enz.3. human. [A6ND91-1]

Polymorphism and mutation databases

BioMutaiASPDH.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471135 Genomic DNA. Translation: EAW71880.1.
AC008743 Genomic DNA. No translation available.
BC066359 mRNA. Translation: AAH66359.1.
CCDSiCCDS33082.1. [A6ND91-2]
CCDS46153.1. [A6ND91-1]
RefSeqiNP_001019827.2. NM_001024656.2. [A6ND91-2]
NP_001108070.1. NM_001114598.1. [A6ND91-1]
UniGeneiHs.436338.

3D structure databases

ProteinModelPortaliA6ND91.
SMRiA6ND91. Positions 8-227.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi299841. 2 interactions.
STRINGi9606.ENSP00000373860.

PTM databases

PhosphoSiteiA6ND91.

Polymorphism and mutation databases

BioMutaiASPDH.

Proteomic databases

PaxDbiA6ND91.
PRIDEiA6ND91.

Protocols and materials databases

DNASUi554235.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000376916; ENSP00000366114; ENSG00000204653. [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653. [A6ND91-1]
GeneIDi554235.
KEGGihsa:554235.
UCSCiuc002psr.4. human. [A6ND91-2]
uc010enz.3. human. [A6ND91-1]

Organism-specific databases

CTDi554235.
GeneCardsiGC19M051014.
HGNCiHGNC:33856. ASPDH.
HPAiHPA042631.
HPA042654.
neXtProtiNX_A6ND91.
PharmGKBiPA164716234.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG73354.
GeneTreeiENSGT00390000004452.
HOGENOMiHOG000007399.
HOVERGENiHBG062283.
InParanoidiA6ND91.
OMAiLELVFVW.
PhylomeDBiA6ND91.
TreeFamiTF315092.

Enzyme and pathway databases

UniPathwayiUPA00253; UER00456.

Miscellaneous databases

GenomeRNAii554235.
NextBioi112458.
PROiA6ND91.

Gene expression databases

BgeeiA6ND91.
ExpressionAtlasiA6ND91. baseline and differential.
GenevestigatoriA6ND91.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
InterProiIPR005106. Asp/hSer_DH_NAD-bd.
IPR002811. Asp_DH.
IPR011182. L-Asp_DH.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamiPF01958. DUF108. 1 hit.
PF03447. NAD_binding_3. 1 hit.
[Graphical view]
PIRSFiPIRSF005227. Asp_dh_NAD_syn. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-266.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-266.
    Tissue: Brain.
  4. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20 AND SER-168, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiASPD_HUMAN
AccessioniPrimary (citable) accession number: A6ND91
Secondary accession number(s): Q6NZ37
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: April 29, 2015
This is version 71 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia.By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.