Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A6ND91

- ASPD_HUMAN

UniProt

A6ND91 - ASPD_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Putative L-aspartate dehydrogenase

Gene

ASPDH

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.By similarity

Catalytic activityi

L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei127 – 1271NAD; via amide nitrogenBy similarity
Binding sitei192 – 1921NADBy similarity

GO - Molecular functioni

  1. aspartate dehydrogenase activity Source: UniProtKB-EC
  2. NADP binding Source: InterPro

GO - Biological processi

  1. NAD biosynthetic process Source: UniProtKB-UniPathway
  2. NADP catabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Pyridine nucleotide biosynthesis

Keywords - Ligandi

NAD, NADP

Enzyme and pathway databases

UniPathwayiUPA00253; UER00456.

Names & Taxonomyi

Protein namesi
Recommended name:
Putative L-aspartate dehydrogenase (EC:1.4.1.21)
Alternative name(s):
Aspartate dehydrogenase domain-containing protein
Gene namesi
Name:ASPDH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:33856. ASPDH.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164716234.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 283283Putative L-aspartate dehydrogenasePRO_0000300623Add
BLAST

Proteomic databases

PaxDbiA6ND91.
PRIDEiA6ND91.

PTM databases

PhosphoSiteiA6ND91.

Expressioni

Gene expression databases

BgeeiA6ND91.
ExpressionAtlasiA6ND91. baseline and differential.
GenevestigatoriA6ND91.

Organism-specific databases

HPAiHPA042631.
HPA042654.

Interactioni

Protein-protein interaction databases

BioGridi299841. 2 interactions.
STRINGi9606.ENSP00000373860.

Structurei

3D structure databases

ProteinModelPortaliA6ND91.
SMRiA6ND91. Positions 9-227.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the L-aspartate dehydrogenase family.Curated

Phylogenomic databases

eggNOGiNOG73354.
GeneTreeiENSGT00390000004452.
HOGENOMiHOG000007399.
HOVERGENiHBG062283.
InParanoidiA6ND91.
OMAiLAFVWNR.
PhylomeDBiA6ND91.
TreeFamiTF315092.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
InterProiIPR005106. Asp/hSer_DH_NAD-bd.
IPR002811. Asp_DH.
IPR011182. L-Asp_DH.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamiPF01958. DUF108. 1 hit.
PF03447. NAD_binding_3. 1 hit.
[Graphical view]
PIRSFiPIRSF005227. Asp_dh_NAD_syn. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A6ND91-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADRGPWRVG VVGYGRLGQS LVSRLLAQGP ELGLELVFVW NRDPGRMAGS
60 70 80 90 100
VPPSLQLQNL AALGERRPDL VVEVAHPKII HESGAQILRH ANLLVGSPSA
110 120 130 140 150
LSDQTTERQL LEASQHWDHA VFVARGALWG AEDIRRLDAA GGLRSLRVTM
160 170 180 190 200
ATHPDGFRLE GPLAAAHSPG PCTVLYEGPV RGLCPFAPRN SNTMAAAALA
210 220 230 240 250
APSLGFDGVI GVLVADTSLT DMHVVDVELS GPRGPTGRSF AVHTRRENPA
260 270 280
EPGAVTGSAT VTAFWQSLLA CCQLPSRPGI HLC
Length:283
Mass (Da):29,946
Last modified:September 11, 2007 - v2
Checksum:iFF4254EF3F14D840
GO
Isoform 2 (identifier: A6ND91-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS
     95-144: Missing.

Show »
Length:178
Mass (Da):18,655
Checksum:i132E8AE73F175366
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti266 – 2661Q → R.2 Publications
Corresponds to variant rs12977172 [ dbSNP | Ensembl ].
VAR_062676

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 6564ADRGP…AALGE → GDRVKGSKS in isoform 2. 1 PublicationVSP_038742Add
BLAST
Alternative sequencei95 – 14450Missing in isoform 2. 1 PublicationVSP_038743Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471135 Genomic DNA. Translation: EAW71880.1.
AC008743 Genomic DNA. No translation available.
BC066359 mRNA. Translation: AAH66359.1.
CCDSiCCDS33082.1. [A6ND91-2]
CCDS46153.1. [A6ND91-1]
RefSeqiNP_001019827.2. NM_001024656.2. [A6ND91-2]
NP_001108070.1. NM_001114598.1. [A6ND91-1]
UniGeneiHs.436338.

Genome annotation databases

EnsembliENST00000376916; ENSP00000366114; ENSG00000204653. [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653. [A6ND91-1]
GeneIDi554235.
KEGGihsa:554235.
UCSCiuc002psr.4. human. [A6ND91-2]
uc010enz.3. human. [A6ND91-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471135 Genomic DNA. Translation: EAW71880.1 .
AC008743 Genomic DNA. No translation available.
BC066359 mRNA. Translation: AAH66359.1 .
CCDSi CCDS33082.1. [A6ND91-2 ]
CCDS46153.1. [A6ND91-1 ]
RefSeqi NP_001019827.2. NM_001024656.2. [A6ND91-2 ]
NP_001108070.1. NM_001114598.1. [A6ND91-1 ]
UniGenei Hs.436338.

3D structure databases

ProteinModelPortali A6ND91.
SMRi A6ND91. Positions 9-227.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 299841. 2 interactions.
STRINGi 9606.ENSP00000373860.

PTM databases

PhosphoSitei A6ND91.

Proteomic databases

PaxDbi A6ND91.
PRIDEi A6ND91.

Protocols and materials databases

DNASUi 554235.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000376916 ; ENSP00000366114 ; ENSG00000204653 . [A6ND91-2 ]
ENST00000389208 ; ENSP00000373860 ; ENSG00000204653 . [A6ND91-1 ]
GeneIDi 554235.
KEGGi hsa:554235.
UCSCi uc002psr.4. human. [A6ND91-2 ]
uc010enz.3. human. [A6ND91-1 ]

Organism-specific databases

CTDi 554235.
GeneCardsi GC19M051014.
HGNCi HGNC:33856. ASPDH.
HPAi HPA042631.
HPA042654.
neXtProti NX_A6ND91.
PharmGKBi PA164716234.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG73354.
GeneTreei ENSGT00390000004452.
HOGENOMi HOG000007399.
HOVERGENi HBG062283.
InParanoidi A6ND91.
OMAi LAFVWNR.
PhylomeDBi A6ND91.
TreeFami TF315092.

Enzyme and pathway databases

UniPathwayi UPA00253 ; UER00456 .

Miscellaneous databases

GenomeRNAii 554235.
NextBioi 112458.
PROi A6ND91.

Gene expression databases

Bgeei A6ND91.
ExpressionAtlasi A6ND91. baseline and differential.
Genevestigatori A6ND91.

Family and domain databases

Gene3Di 3.40.50.720. 1 hit.
InterProi IPR005106. Asp/hSer_DH_NAD-bd.
IPR002811. Asp_DH.
IPR011182. L-Asp_DH.
IPR016040. NAD(P)-bd_dom.
[Graphical view ]
Pfami PF01958. DUF108. 1 hit.
PF03447. NAD_binding_3. 1 hit.
[Graphical view ]
PIRSFi PIRSF005227. Asp_dh_NAD_syn. 1 hit.
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-266.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-266.
    Tissue: Brain.

Entry informationi

Entry nameiASPD_HUMAN
AccessioniPrimary (citable) accession number: A6ND91
Secondary accession number(s): Q6NZ37
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: October 29, 2014
This is version 68 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia.By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3