Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A6H8Y1

- BDP1_HUMAN

UniProt

A6H8Y1 - BDP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcription factor TFIIIB component B'' homolog

Gene

BDP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

General activator of RNA polymerase III transcription. Requires for transcription from all three types of polymerase III promoters. Requires for transcription of genes with internal promoter elements and with promoter elements upstream of the initiation site.1 Publication

GO - Molecular functioni

  1. chromatin binding Source: InterPro
  2. DNA binding Source: InterPro

GO - Biological processi

  1. gene expression Source: Reactome
  2. regulation of transcription, DNA-templated Source: UniProtKB-KW
  3. transcription from RNA polymerase III promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiREACT_1036. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
REACT_347. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
REACT_571. RNA Polymerase III Transcription Initiation From Type 3 Promoter.
SignaLinkiA6H8Y1.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor TFIIIB component B'' homolog
Alternative name(s):
Transcription factor IIIB 150
Short name:
TFIIIB150
Transcription factor-like nuclear regulator
Gene namesi
Name:BDP1
Synonyms:KIAA1241, KIAA1689, TFNR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5, UP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:13652. BDP1.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleoplasm Source: Reactome
  3. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi390 – 3901S → A: Not phosphorylated by CSNK2A1; when associated with A-426; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-426; A-431; A-437 and A-446. 1 Publication
Mutagenesisi426 – 4261S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-431; A-437 and A-446. 1 Publication
Mutagenesisi431 – 4311S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-437 and A-446. 1 Publication
Mutagenesisi437 – 4371T → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-446. 1 Publication
Mutagenesisi446 – 4461S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-437. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-437. 1 Publication

Organism-specific databases

PharmGKBiPA25336.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 26242624Transcription factor TFIIIB component B'' homologPRO_0000333863Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei915 – 9151Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylated by CSNK2A1 during mitosis, resulting in its release from chromatin and suppression of polymerase III transcription.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA6H8Y1.
PaxDbiA6H8Y1.
PRIDEiA6H8Y1.

PTM databases

PhosphoSiteiA6H8Y1.

Expressioni

Tissue specificityi

Isoform 2 is highly expressed in cerebellum.1 Publication

Inductioni

By Epstein-Barr virus (EBV) resulting in the stimulation of the EBV EBER genes.1 Publication

Gene expression databases

BgeeiA6H8Y1.
CleanExiHS_BDP1.
ExpressionAtlasiA6H8Y1. baseline and differential.
GenevestigatoriA6H8Y1.

Organism-specific databases

HPAiHPA043140.
HPA049726.

Interactioni

Subunit structurei

Component of TFIIIB complex. The TFIIIB complex has two activities, alpha and beta. The TFIIIB-alpha and TFIIIB-beta activities are required for transcription of genes with TFIIIC-bound internal promoters and PSE transcription factor-bound external promoters, respectively. The TFIIIB-alpha activity complex is composed of TBP, BDP1, and a complex containing both BRF2 and at least four stably associated proteins; YY1 facilitates the formation of TFIIIB-alpha activity complex. The TFIIIB-beta activity complex is composed of TBP, BDP1, and BRF1. Interacts with BRF1; this interaction diminishes during mitosis resulting in the release of BDP1 from chromosomal templates. Component of TFIIIC complex. The TFIIIC complex has two activities, C1 and C2. The TFIIIC2 activity complex is only required for transcription of the 'classical' pol III genes whereas the TFIIIC1 activity complex is required for transcription of all pol III genes. The TFIIIC1 activity complex is composed at least of BDP1. Interacts with ZBTB43.3 Publications

Protein-protein interaction databases

BioGridi120924. 1 interaction.
IntActiA6H8Y1. 1 interaction.
MINTiMINT-5003529.

Structurei

3D structure databases

ProteinModelPortaliA6H8Y1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini295 – 34551Myb-likeAdd
BLAST
Repeati823 – 877551; approximateAdd
BLAST
Repeati878 – 932552Add
BLAST
Repeati933 – 987553Add
BLAST
Repeati988 – 1040534Add
BLAST
Repeati1041 – 1094545Add
BLAST
Repeati1095 – 1148546Add
BLAST
Repeati1149 – 1203557Add
BLAST
Repeati1204 – 1257548; approximateAdd
BLAST
Repeati1258 – 1327709; approximateAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 299299Interaction with ZBTB43Add
BLAST
Regioni355 – 470116Required for phosphorylation by CSNK2A1Add
BLAST
Regioni823 – 13275059 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-TAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili144 – 17734Sequence AnalysisAdd
BLAST
Coiled coili1078 – 110326Sequence AnalysisAdd
BLAST
Coiled coili1223 – 128462Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi84 – 11936Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 Myb-like domain.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiCOG5118.
GeneTreeiENSGT00390000012762.
HOVERGENiHBG107497.
KOiK15198.
OMAiKPNIGRG.
PhylomeDBiA6H8Y1.
TreeFamiTF328878.

Family and domain databases

InterProiIPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
[Graphical view]
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A6H8Y1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFRRARLSVK PNVRPGVGAR GSTASNPQRG RESPRPPDPA TDSASKPAEP
60 70 80 90 100
TDVPTVDFGG AEPQEKAPRS STEKTGGDND VEESSRSSST VSQRRKRISS
110 120 130 140 150
TSSLVKSSVS VPSESHPLST INQEAPQPTA TSTKEKQPCS DRYRIYKAQK
160 170 180 190 200
LREMLKEELR KEKKQWKNKY AINESQRPPD RSKMTMRDFI YYLPDNNPMT
210 220 230 240 250
SSLEQEKKTE KPSTPVQTRE QEGKSTPNAE DNEMEEETDD GPLLVPRVKV
260 270 280 290 300
AEDGSIILDE ESLTVEVLRT KGPCVVEEND PIFERGSTTT YSSFRKNYYS
310 320 330 340 350
KPWSNKETDM FFLAISMVGT DFSMIGQLFP HRARIEIKNK FKREEKTNGW
360 370 380 390 400
RIDKAFQEKR PFDFDFFAHL LQKVLAEEEK RKQKSVKNHS LKEKKSTKPR
410 420 430 440 450
KNVKVKKVAC EGVNNDPDES MSSRISDTER SQKDAQTVEE ESLTLSREDA
460 470 480 490 500
EQVALEVDLN QKKRRRKKQD GANELGVNNL LENATVQAGP SKGEKHKNKC
510 520 530 540 550
QAIRPELKEG ECSKEQMLSC TQNIDGIVGF ASTEKVEKRT DPILSLSNQQ
560 570 580 590 600
DATSVATESS ESSTSDLPSF EVGIRALCEV NNAEGSCIEE RNVDLKNNSL
610 620 630 640 650
EIDQTENVKP MLRGRFQRPK PNLSRAGKKS VLSQGKTESE SKNSHSKTSV
660 670 680 690 700
EKNHVEKDKM NTLDILRMET TERENPEAET VSVLGEKNCL QEGSQLKALR
710 720 730 740 750
PVQVRGRLQK PKPNAGKAAE RKEILISQEE IGANVEKNEN ESCADRDTPQ
760 770 780 790 800
HMEDQSRKDF EEEDVILQPE KNDSFQNVQP DEPKVLNECL SVQENNKANK
810 820 830 840 850
LNQVPILRTR FQKPKPNIGR GTGRREISSK EEVLEKILVS GEMAAALRET
860 870 880 890 900
VRLDTSPKEM VPAEINTKEM QSDLKETGRR AISPREKILD VIDDTIEMET
910 920 930 940 950
GLKAMGREIC LREKTPEVID ATEEIDKDLE EAGRREISPQ KNGPEEVKPL
960 970 980 990 1000
GEVETDLKAT GNESSPREKT PEVTDATEEI DKNLEETGRR KISPRENGPE
1010 1020 1030 1040 1050
EVKPVDEMET DLNATGRESS PREKTPEVID ATEEIDLEET EREVSPQENG
1060 1070 1080 1090 1100
LEEVKPLGEM ETDLKATGRD SFPRGKTPEV IDAIEEIEID LEETEREISP
1110 1120 1130 1140 1150
QENGLEEVKP LGEMQTDLKA TGREISPREK TPEVIDATEE IDKDLEETGR
1160 1170 1180 1190 1200
REISPEENGP EEVKPVDEME TDLKTTGREG SSREKTREVI DAAEVIETDL
1210 1220 1230 1240 1250
EETEREISPQ ENGPEEVKPV GKMETDLKEI REEISQREKV LAEFSAIREK
1260 1270 1280 1290 1300
EIDLKETGKR DIPIMEKVSG KMAVVEEMEA DLKETGKENF RERGSEEICV
1310 1320 1330 1340 1350
TEEKVAELKQ TGKTDISPRE NELEETSTSR QTDTHLMQSG SNDFSAVPSL
1360 1370 1380 1390 1400
DIQNISSEVL SMMHTPVEEK RNSEKEVSSH FSHFKISSQT HESDKTEVQG
1410 1420 1430 1440 1450
IQSPDVPEQF SDINLSKSLP QEQKPLEIKP APFVRSRFKR PKPNLARAAL
1460 1470 1480 1490 1500
KRETTESEKY IYEKKSETKK METIVMQENN EQTDTLPSQH DEASLMISRE
1510 1520 1530 1540 1550
KDTLGHRNEE AVILPCTQTE RNLSPSNSCE PKEESQSAPV QKNDSVVSVG
1560 1570 1580 1590 1600
TNNVNTFQQE MKESVIQTAR QVRGRLQRPR PNIRKTGQRQ IVDKGEAKGI
1610 1620 1630 1640 1650
IKEGRTILPK DETEKKVLTV SNSQIETEIE VPSSAVPEHR MYENQSQVVL
1660 1670 1680 1690 1700
VENLHVNKTN ETIRHENKPY VPSSAQMTRR KFQKAKPNLG RAHSKKEEPV
1710 1720 1730 1740 1750
LEKVTTDQSK EGKPEDHLLQ KGASNTQLLL KEKAELLTSL EVSARKDCVG
1760 1770 1780 1790 1800
SKESALAKID AELEEVGPSR RVGEETVGDN SPSSVVEEQY LNKLTSCPQP
1810 1820 1830 1840 1850
LNETSYSKIA LDGKTTISST SEYERNRGER RSHKKFKPNV TRGRGSKRVR
1860 1870 1880 1890 1900
GKTSKKEPRA SKAMLVTLRA SQEEDDDADD FESDYEEESY HLAPEEVNKA
1910 1920 1930 1940 1950
PVFVPVGLRS PEPVSAQIEE TMEELEITVN VPDVGCIAVV EHELPNTDVT
1960 1970 1980 1990 2000
TEEMKQEENL SVPFEMTTSE HIQDEPGTND GSTEAAITLL TMGDLVLQSE
2010 2020 2030 2040 2050
ISSEQGDVGV CIIPHVHSKD KSHIPSSLDN VNHKIVHECQ ELSSPVITTS
2060 2070 2080 2090 2100
PASFEENKIV LEEQSSREEI SLMEKVKENA TPTRNTISKV TSNLRIRSRL
2110 2120 2130 2140 2150
AKPKPNLEKT LGTNRLDDYQ EVSSLCVTKG AEMETQRETE KNASKATELE
2160 2170 2180 2190 2200
NKNLGPVTTA ENKDQSKLAC VHGIKGTSIS SEVNLTERNE NQEESSQEVH
2210 2220 2230 2240 2250
MLSVAPVASS ETGPCTLGLD RGLGENSVEE PQIKDSKGDS VLTLPVPEYT
2260 2270 2280 2290 2300
PTSIPEVQQE NIINPQDLTV NLVANVPQDG EDEQAFILTL VEIPANAVEE
2310 2320 2330 2340 2350
FTDATAQFMP NPLLPAPILV KSVNTEERGD MSICLPATSV GQDAMGLSIS
2360 2370 2380 2390 2400
GRDNSKKPPD NLDLVSRKRF QCRLDKNDHI PPAKKRSLTL RDDCQEYTTE
2410 2420 2430 2440 2450
VHSKELTNVF EETGESHKGQ DIFLTSGSTL TTPEPQRQQV EAAFQSRGSR
2460 2470 2480 2490 2500
SPDACMDKNV PQLPQDEMIV SDKEERTDAA PKSQQMDSRT SSSKASLSRP
2510 2520 2530 2540 2550
GRRPLGFLSL ICSKNSLESD EPMQVHSKKR LKPLIPGLRK KLKRSNPFNE
2560 2570 2580 2590 2600
SQEKNRESSD LLPSPSVITT QSENISSSAT QVSCDQPLLK EGYKSAQKRA
2610 2620
PQGEATTVSE YFFNDIFIEV DETE
Length:2,624
Mass (Da):293,885
Last modified:January 11, 2011 - v3
Checksum:iCB7B80EBBF06B557
GO
Isoform 2 (identifier: A6H8Y1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2249-2254: YTPTSI → VKECTV
     2255-2624: Missing.

Show »
Length:2,254
Mass (Da):252,841
Checksum:i5028C313143A257A
GO
Isoform 3 (identifier: A6H8Y1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTLKNL
     1389-2624: Missing.

Show »
Length:1,388
Mass (Da):156,401
Checksum:iCA5A8B8025222C59
GO
Isoform 4 (identifier: A6H8Y1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1372: NISSEVLSMMHTPVEEKRN → VCIFLSFKSFLNAFFRGNK
     1373-2624: Missing.

Show »
Length:1,372
Mass (Da):154,704
Checksum:iE9E1E54C426362F8
GO
Isoform 5 (identifier: A6H8Y1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-610: Missing.
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTFKNL
     1389-2624: Missing.

Note: No experimental confirmation available.

Show »
Length:778
Mass (Da):87,789
Checksum:iB0472F9FC6FB6897
GO
Isoform 6 (identifier: A6H8Y1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-43: Missing.

Note: No experimental confirmation available.

Show »
Length:2,604
Mass (Da):291,768
Checksum:i006AAB63089EB64F
GO
Isoform 7 (identifier: A6H8Y1-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1977-2008: Missing.
     2582-2584: VSC → RPF
     2585-2624: Missing.

Note: No experimental confirmation available.

Show »
Length:2,552
Mass (Da):286,185
Checksum:iF159FF75502B6844
GO
Isoform 8 (identifier: A6H8Y1-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1863: Missing.
     2008-2008: Missing.
     2271-2327: NLVANVPQDG...ILVKSVNTEE → FVYQQLQLVK...FLLPKNVHSL
     2328-2624: Missing.

Note: No experimental confirmation available.

Show »
Length:463
Mass (Da):51,420
Checksum:i054AFA93526C7083
GO

Sequence cautioni

The sequence AAG09268.1 differs from that shown. Reason: Frameshift at positions 837 and 863. Curated
The sequence AAH32146.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA86555.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB21780.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAH18085.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 81S → N in AAG09268. 1 PublicationCurated
Sequence conflicti233 – 2331E → G in AAG30221. (PubMed:11040218)Curated
Sequence conflicti233 – 2331E → G in AAG30220. (PubMed:11040218)Curated
Sequence conflicti575 – 5751R → K in BAB71602. (PubMed:14702039)Curated
Sequence conflicti683 – 6831V → D in CAC21448. (PubMed:11161782)Curated
Sequence conflicti881 – 8811A → T in AAG09268. 1 PublicationCurated
Sequence conflicti973 – 9731V → G in CAC21448. (PubMed:11161782)Curated
Sequence conflicti973 – 9731V → G in CAC04245. (PubMed:11161782)Curated
Sequence conflicti1009 – 10091E → G in AAG30221. (PubMed:11040218)Curated
Sequence conflicti1009 – 10091E → G in AAG30220. (PubMed:11040218)Curated
Sequence conflicti2580 – 25801T → A in CAE46010. (PubMed:17974005)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti26 – 261N → S.
Corresponds to variant rs3748042 [ dbSNP | Ensembl ].
VAR_056743
Natural varianti38 – 381D → E.4 Publications
Corresponds to variant rs3748043 [ dbSNP | Ensembl ].
VAR_043312
Natural varianti125 – 1251A → V.
Corresponds to variant rs9687593 [ dbSNP | Ensembl ].
VAR_056744
Natural varianti722 – 7221K → E.
Corresponds to variant rs36009281 [ dbSNP | Ensembl ].
VAR_056745
Natural varianti757 – 7571R → C.3 Publications
Corresponds to variant rs3761966 [ dbSNP | Ensembl ].
VAR_043313
Natural varianti778 – 7781V → M.
Corresponds to variant rs3761967 [ dbSNP | Ensembl ].
VAR_043314
Natural varianti1180 – 11801G → S.
Corresponds to variant rs715748 [ dbSNP | Ensembl ].
VAR_056746
Natural varianti1244 – 12441F → I.2 Publications
Corresponds to variant rs1961760 [ dbSNP | Ensembl ].
VAR_056747
Natural varianti1264 – 12641I → M.3 Publications
Corresponds to variant rs715747 [ dbSNP | Ensembl ].
VAR_043315
Natural varianti1347 – 13471V → M.5 Publications
Corresponds to variant rs6886336 [ dbSNP | Ensembl ].
VAR_043316
Natural varianti1469 – 14691K → E.2 Publications
Corresponds to variant rs1698063 [ dbSNP | Ensembl ].
VAR_043317
Natural varianti1676 – 16761Q → E.
Corresponds to variant rs12187098 [ dbSNP | Ensembl ].
VAR_056748
Natural varianti2013 – 20131I → L.2 Publications
Corresponds to variant rs6453014 [ dbSNP | Ensembl ].
VAR_043318
Natural varianti2555 – 25551N → S.
Corresponds to variant rs17276250 [ dbSNP | Ensembl ].
VAR_056749

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 18631863Missing in isoform 8. 1 PublicationVSP_033567Add
BLAST
Alternative sequencei1 – 610610Missing in isoform 5. 1 PublicationVSP_033568Add
BLAST
Alternative sequencei24 – 4320Missing in isoform 6. 1 PublicationVSP_033569Add
BLAST
Alternative sequencei1354 – 138835NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTLKNL in isoform 3. 1 PublicationVSP_033570Add
BLAST
Alternative sequencei1354 – 138835NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTFKNL in isoform 5. 1 PublicationVSP_033571Add
BLAST
Alternative sequencei1354 – 137219NISSE…EEKRN → VCIFLSFKSFLNAFFRGNK in isoform 4. 1 PublicationVSP_033572Add
BLAST
Alternative sequencei1373 – 26241252Missing in isoform 4. 1 PublicationVSP_033573Add
BLAST
Alternative sequencei1389 – 26241236Missing in isoform 3 and isoform 5. 2 PublicationsVSP_033574Add
BLAST
Alternative sequencei1977 – 200832Missing in isoform 7. 1 PublicationVSP_033575Add
BLAST
Alternative sequencei2008 – 20081Missing in isoform 8. 1 PublicationVSP_033576
Alternative sequencei2249 – 22546YTPTSI → VKECTV in isoform 2. 1 PublicationVSP_033577
Alternative sequencei2255 – 2624370Missing in isoform 2. 1 PublicationVSP_033578Add
BLAST
Alternative sequencei2271 – 232757NLVAN…VNTEE → FVYQQLQLVKMPWVYLFLEE IILKSRLIIWILYLGRDFNA GLIKMTTFLLPKNVHSL in isoform 8. 1 PublicationVSP_033579Add
BLAST
Alternative sequencei2328 – 2624297Missing in isoform 8. 1 PublicationVSP_033580Add
BLAST
Alternative sequencei2582 – 25843VSC → RPF in isoform 7. 1 PublicationVSP_033581
Alternative sequencei2585 – 262440Missing in isoform 7. 1 PublicationVSP_033582Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF298151 mRNA. Translation: AAG30220.1.
AF298152 mRNA. Translation: AAG30221.1.
AJ238520 mRNA. Translation: CAC04245.1.
AJ278892 Genomic DNA. Translation: CAC17771.1.
AJ279120
, AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA. Translation: CAC21448.1.
AB033067 mRNA. Translation: BAA86555.1. Different initiation.
AB051476 mRNA. Translation: BAB21780.3. Different initiation.
BX641011 mRNA. Translation: CAE46010.1.
CR749229 mRNA. Translation: CAH18085.1. Different initiation.
CR749289 mRNA. Translation: CAH18144.1.
AC138832 Genomic DNA. No translation available.
BC032146 mRNA. Translation: AAH32146.1. Sequence problems.
BC146792 mRNA. Translation: AAI46793.1.
AF176695 mRNA. Translation: AAG09268.1. Frameshift.
AK057871 mRNA. Translation: BAB71602.1.
CCDSiCCDS43328.1. [A6H8Y1-1]
RefSeqiNP_060899.2. NM_018429.2. [A6H8Y1-1]
UniGeneiHs.258272.

Genome annotation databases

EnsembliENST00000358731; ENSP00000351575; ENSG00000145734. [A6H8Y1-1]
ENST00000617085; ENSP00000482469; ENSG00000273873. [A6H8Y1-1]
GeneIDi55814.
KEGGihsa:55814.
UCSCiuc003kbn.1. human. [A6H8Y1-4]
uc003kbo.3. human. [A6H8Y1-2]
uc003kbp.1. human. [A6H8Y1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF298151 mRNA. Translation: AAG30220.1 .
AF298152 mRNA. Translation: AAG30221.1 .
AJ238520 mRNA. Translation: CAC04245.1 .
AJ278892 Genomic DNA. Translation: CAC17771.1 .
AJ279120
, AJ279121 , AJ279122 , AJ279123 , AJ279124 , AJ279125 , AJ279126 , AJ279127 , AJ279128 , AJ279129 , AJ279130 , AJ279131 , AJ279132 , AJ279133 , AJ279134 , AJ279135 , AJ279136 , AJ279137 , AJ279138 , AJ279139 , AJ279140 , AJ279141 , AJ279142 , AJ279143 , AJ279144 , AJ279145 , AJ279146 , AJ279147 , AJ279148 , AJ279149 , AJ279150 Genomic DNA. Translation: CAC21448.1 .
AB033067 mRNA. Translation: BAA86555.1 . Different initiation.
AB051476 mRNA. Translation: BAB21780.3 . Different initiation.
BX641011 mRNA. Translation: CAE46010.1 .
CR749229 mRNA. Translation: CAH18085.1 . Different initiation.
CR749289 mRNA. Translation: CAH18144.1 .
AC138832 Genomic DNA. No translation available.
BC032146 mRNA. Translation: AAH32146.1 . Sequence problems.
BC146792 mRNA. Translation: AAI46793.1 .
AF176695 mRNA. Translation: AAG09268.1 . Frameshift.
AK057871 mRNA. Translation: BAB71602.1 .
CCDSi CCDS43328.1. [A6H8Y1-1 ]
RefSeqi NP_060899.2. NM_018429.2. [A6H8Y1-1 ]
UniGenei Hs.258272.

3D structure databases

ProteinModelPortali A6H8Y1.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120924. 1 interaction.
IntActi A6H8Y1. 1 interaction.
MINTi MINT-5003529.

PTM databases

PhosphoSitei A6H8Y1.

Proteomic databases

MaxQBi A6H8Y1.
PaxDbi A6H8Y1.
PRIDEi A6H8Y1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358731 ; ENSP00000351575 ; ENSG00000145734 . [A6H8Y1-1 ]
ENST00000617085 ; ENSP00000482469 ; ENSG00000273873 . [A6H8Y1-1 ]
GeneIDi 55814.
KEGGi hsa:55814.
UCSCi uc003kbn.1. human. [A6H8Y1-4 ]
uc003kbo.3. human. [A6H8Y1-2 ]
uc003kbp.1. human. [A6H8Y1-1 ]

Organism-specific databases

CTDi 55814.
GeneCardsi GC05P070787.
H-InvDB HIX0004927.
HGNCi HGNC:13652. BDP1.
HPAi HPA043140.
HPA049726.
MIMi 607012. gene.
neXtProti NX_A6H8Y1.
PharmGKBi PA25336.
HUGEi Search...
Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5118.
GeneTreei ENSGT00390000012762.
HOVERGENi HBG107497.
KOi K15198.
OMAi KPNIGRG.
PhylomeDBi A6H8Y1.
TreeFami TF328878.

Enzyme and pathway databases

Reactomei REACT_1036. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
REACT_347. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
REACT_571. RNA Polymerase III Transcription Initiation From Type 3 Promoter.
SignaLinki A6H8Y1.

Miscellaneous databases

ChiTaRSi BDP1. human.
GeneWikii BDP1.
GenomeRNAii 55814.
NextBioi 60990.
PROi A6H8Y1.
SOURCEi Search...

Gene expression databases

Bgeei A6H8Y1.
CleanExi HS_BDP1.
ExpressionAtlasi A6H8Y1. baseline and differential.
Genevestigatori A6H8Y1.

Family and domain databases

InterProi IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
[Graphical view ]
SMARTi SM00717. SANT. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Different human TFIIIB activities direct RNA polymerase III transcription from TATA-containing and TATA-less promoters."
    Schramm L., Pendergrast P.S., Sun Y., Hernandez N.
    Genes Dev. 14:2650-2663(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, VARIANTS GLU-38 AND MET-1347.
  2. "The transcription factor-like nuclear regulator (TFNR) contains a novel 55-amino-acid motif repeated nine times and maps closely to SMN1."
    Kelter A.R., Herchenbach J., Wirth B.
    Genomics 70:315-326(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-2187 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2189-2624 (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS GLU-38; MET-1347 AND LEU-2013.
  3. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANTS CYS-757; MET-1264 AND MET-1347.
    Tissue: Brain.
  4. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469.
    Tissue: Brain.
  5. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1947-2624 (ISOFORM 7), VARIANT LEU-2013.
    Tissue: Testis.
  7. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469.
    Tissue: Lung.
  9. "Molecular cloning and functional characterization of human TFIIIB 150."
    Teichmann M., Wang Z., Ito M., Seifart K.H., Roeder R.G.
    Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-881 (ISOFORM 1).
  10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-655 (ISOFORM 6).
    Tissue: Brain.
  11. "A stable complex of a novel transcription factor IIB- related factor, human TFIIIB50, and associated proteins mediate selective transcription by RNA polymerase III of genes with upstream promoter elements."
    Teichmann M., Wang Z., Roeder R.G.
    Proc. Natl. Acad. Sci. U.S.A. 97:14200-14205(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF TFIIIB-ALPHA COMPLEX.
  12. "TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo."
    Fairley J.A., Scott P.H., White R.J.
    EMBO J. 22:5841-5850(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BRF1.
  13. "Transcription factor (TF)-like nuclear regulator, the 250-kDa form of Homo sapiens TFIIIB', is an essential component of human TFIIIC1 activity."
    Weser S., Gruber C., Hafner H.M., Teichmann M., Roeder R.G., Seifart K.H., Meissner W.
    J. Biol. Chem. 279:27022-27029(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF TFIIIC1 COMPLEX.
  14. "CK2 phosphorylation of Bdp1 executes cell cycle-specific RNA polymerase III transcription repression."
    Hu P., Samudre K., Wu S., Sun Y., Hernandez N.
    Mol. Cell 16:81-92(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION, MUTAGENESIS OF SER-390; SER-426; SER-431; THR-437 AND SER-446.
  15. "The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB."
    Schoenen F., Wirth B.
    Biol. Chem. 387:277-284(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ZBTB43.
  16. "A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes."
    Emran F., Florens L., Ma B., Swanson S.K., Washburn M.P., Hernandez N.
    Gene 377:96-108(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT.
  17. "Epstein-Barr virus induces cellular transcription factors to allow active expression of EBER genes by RNA polymerase III."
    Felton-Edkins Z.A., Kondrashov A., Karali D., Fairley J.A., Dawson C.W., Arrand J.R., Young L.S., White R.J.
    J. Biol. Chem. 281:33871-33880(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  18. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiBDP1_HUMAN
AccessioniPrimary (citable) accession number: A6H8Y1
Secondary accession number(s): Q68DS6
, Q68DY5, Q6MZL9, Q6PIM7, Q86W98, Q96LR8, Q9C0H4, Q9H197, Q9H1A1, Q9HAW1, Q9HAW2, Q9HCY0, Q9ULH9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: January 11, 2011
Last modified: October 29, 2014
This is version 69 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3