Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A6H8Y1

- BDP1_HUMAN

UniProt

A6H8Y1 - BDP1_HUMAN

Protein

Transcription factor TFIIIB component B'' homolog

Gene

BDP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 68 (01 Oct 2014)
      Sequence version 3 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    General activator of RNA polymerase III transcription. Requires for transcription from all three types of polymerase III promoters. Requires for transcription of genes with internal promoter elements and with promoter elements upstream of the initiation site.1 Publication

    GO - Molecular functioni

    1. chromatin binding Source: InterPro
    2. DNA binding Source: InterPro

    GO - Biological processi

    1. gene expression Source: Reactome
    2. regulation of transcription, DNA-templated Source: UniProtKB-KW
    3. transcription from RNA polymerase III promoter Source: Reactome

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Enzyme and pathway databases

    ReactomeiREACT_1036. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
    REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
    REACT_347. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
    REACT_571. RNA Polymerase III Transcription Initiation From Type 3 Promoter.
    SignaLinkiA6H8Y1.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transcription factor TFIIIB component B'' homolog
    Alternative name(s):
    Transcription factor IIIB 150
    Short name:
    TFIIIB150
    Transcription factor-like nuclear regulator
    Gene namesi
    Name:BDP1
    Synonyms:KIAA1241, KIAA1689, TFNR
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:13652. BDP1.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleoplasm Source: Reactome
    3. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi390 – 3901S → A: Not phosphorylated by CSNK2A1; when associated with A-426; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-426; A-431; A-437 and A-446. 1 Publication
    Mutagenesisi426 – 4261S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-431; A-437 and A-446. 1 Publication
    Mutagenesisi431 – 4311S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-437 and A-446. 1 Publication
    Mutagenesisi437 – 4371T → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-446. 1 Publication
    Mutagenesisi446 – 4461S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-437. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-437. 1 Publication

    Organism-specific databases

    PharmGKBiPA25336.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 26242624Transcription factor TFIIIB component B'' homologPRO_0000333863Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei915 – 9151Phosphothreonine2 Publications

    Post-translational modificationi

    Phosphorylated by CSNK2A1 during mitosis, resulting in its release from chromatin and suppression of polymerase III transcription.2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiA6H8Y1.
    PaxDbiA6H8Y1.
    PRIDEiA6H8Y1.

    PTM databases

    PhosphoSiteiA6H8Y1.

    Expressioni

    Tissue specificityi

    Isoform 2 is highly expressed in cerebellum.1 Publication

    Inductioni

    By Epstein-Barr virus (EBV) resulting in the stimulation of the EBV EBER genes.1 Publication

    Gene expression databases

    ArrayExpressiA6H8Y1.
    BgeeiA6H8Y1.
    CleanExiHS_BDP1.
    GenevestigatoriA6H8Y1.

    Organism-specific databases

    HPAiHPA043140.
    HPA049726.

    Interactioni

    Subunit structurei

    Component of TFIIIB complex. The TFIIIB complex has two activities, alpha and beta. The TFIIIB-alpha and TFIIIB-beta activities are required for transcription of genes with TFIIIC-bound internal promoters and PSE transcription factor-bound external promoters, respectively. The TFIIIB-alpha activity complex is composed of TBP, BDP1, and a complex containing both BRF2 and at least four stably associated proteins; YY1 facilitates the formation of TFIIIB-alpha activity complex. The TFIIIB-beta activity complex is composed of TBP, BDP1, and BRF1. Interacts with BRF1; this interaction diminishes during mitosis resulting in the release of BDP1 from chromosomal templates. Component of TFIIIC complex. The TFIIIC complex has two activities, C1 and C2. The TFIIIC2 activity complex is only required for transcription of the 'classical' pol III genes whereas the TFIIIC1 activity complex is required for transcription of all pol III genes. The TFIIIC1 activity complex is composed at least of BDP1. Interacts with ZBTB43.3 Publications

    Protein-protein interaction databases

    BioGridi120924. 1 interaction.
    IntActiA6H8Y1. 1 interaction.
    MINTiMINT-5003529.

    Structurei

    3D structure databases

    ProteinModelPortaliA6H8Y1.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini295 – 34551Myb-likeAdd
    BLAST
    Repeati823 – 877551; approximateAdd
    BLAST
    Repeati878 – 932552Add
    BLAST
    Repeati933 – 987553Add
    BLAST
    Repeati988 – 1040534Add
    BLAST
    Repeati1041 – 1094545Add
    BLAST
    Repeati1095 – 1148546Add
    BLAST
    Repeati1149 – 1203557Add
    BLAST
    Repeati1204 – 1257548; approximateAdd
    BLAST
    Repeati1258 – 1327709; approximateAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 299299Interaction with ZBTB43Add
    BLAST
    Regioni355 – 470116Required for phosphorylation by CSNK2A1Add
    BLAST
    Regioni823 – 13275059 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-TAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili144 – 17734Sequence AnalysisAdd
    BLAST
    Coiled coili1078 – 110326Sequence AnalysisAdd
    BLAST
    Coiled coili1223 – 128462Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi84 – 11936Ser-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 Myb-like domain.Curated

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG5118.
    HOVERGENiHBG107497.
    InParanoidiA6H8Y1.
    KOiK15198.
    OMAiKPNIGRG.
    PhylomeDBiA6H8Y1.
    TreeFamiTF328878.

    Family and domain databases

    InterProiIPR009057. Homeodomain-like.
    IPR001005. SANT/Myb.
    [Graphical view]
    SMARTiSM00717. SANT. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A6H8Y1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFRRARLSVK PNVRPGVGAR GSTASNPQRG RESPRPPDPA TDSASKPAEP     50
    TDVPTVDFGG AEPQEKAPRS STEKTGGDND VEESSRSSST VSQRRKRISS 100
    TSSLVKSSVS VPSESHPLST INQEAPQPTA TSTKEKQPCS DRYRIYKAQK 150
    LREMLKEELR KEKKQWKNKY AINESQRPPD RSKMTMRDFI YYLPDNNPMT 200
    SSLEQEKKTE KPSTPVQTRE QEGKSTPNAE DNEMEEETDD GPLLVPRVKV 250
    AEDGSIILDE ESLTVEVLRT KGPCVVEEND PIFERGSTTT YSSFRKNYYS 300
    KPWSNKETDM FFLAISMVGT DFSMIGQLFP HRARIEIKNK FKREEKTNGW 350
    RIDKAFQEKR PFDFDFFAHL LQKVLAEEEK RKQKSVKNHS LKEKKSTKPR 400
    KNVKVKKVAC EGVNNDPDES MSSRISDTER SQKDAQTVEE ESLTLSREDA 450
    EQVALEVDLN QKKRRRKKQD GANELGVNNL LENATVQAGP SKGEKHKNKC 500
    QAIRPELKEG ECSKEQMLSC TQNIDGIVGF ASTEKVEKRT DPILSLSNQQ 550
    DATSVATESS ESSTSDLPSF EVGIRALCEV NNAEGSCIEE RNVDLKNNSL 600
    EIDQTENVKP MLRGRFQRPK PNLSRAGKKS VLSQGKTESE SKNSHSKTSV 650
    EKNHVEKDKM NTLDILRMET TERENPEAET VSVLGEKNCL QEGSQLKALR 700
    PVQVRGRLQK PKPNAGKAAE RKEILISQEE IGANVEKNEN ESCADRDTPQ 750
    HMEDQSRKDF EEEDVILQPE KNDSFQNVQP DEPKVLNECL SVQENNKANK 800
    LNQVPILRTR FQKPKPNIGR GTGRREISSK EEVLEKILVS GEMAAALRET 850
    VRLDTSPKEM VPAEINTKEM QSDLKETGRR AISPREKILD VIDDTIEMET 900
    GLKAMGREIC LREKTPEVID ATEEIDKDLE EAGRREISPQ KNGPEEVKPL 950
    GEVETDLKAT GNESSPREKT PEVTDATEEI DKNLEETGRR KISPRENGPE 1000
    EVKPVDEMET DLNATGRESS PREKTPEVID ATEEIDLEET EREVSPQENG 1050
    LEEVKPLGEM ETDLKATGRD SFPRGKTPEV IDAIEEIEID LEETEREISP 1100
    QENGLEEVKP LGEMQTDLKA TGREISPREK TPEVIDATEE IDKDLEETGR 1150
    REISPEENGP EEVKPVDEME TDLKTTGREG SSREKTREVI DAAEVIETDL 1200
    EETEREISPQ ENGPEEVKPV GKMETDLKEI REEISQREKV LAEFSAIREK 1250
    EIDLKETGKR DIPIMEKVSG KMAVVEEMEA DLKETGKENF RERGSEEICV 1300
    TEEKVAELKQ TGKTDISPRE NELEETSTSR QTDTHLMQSG SNDFSAVPSL 1350
    DIQNISSEVL SMMHTPVEEK RNSEKEVSSH FSHFKISSQT HESDKTEVQG 1400
    IQSPDVPEQF SDINLSKSLP QEQKPLEIKP APFVRSRFKR PKPNLARAAL 1450
    KRETTESEKY IYEKKSETKK METIVMQENN EQTDTLPSQH DEASLMISRE 1500
    KDTLGHRNEE AVILPCTQTE RNLSPSNSCE PKEESQSAPV QKNDSVVSVG 1550
    TNNVNTFQQE MKESVIQTAR QVRGRLQRPR PNIRKTGQRQ IVDKGEAKGI 1600
    IKEGRTILPK DETEKKVLTV SNSQIETEIE VPSSAVPEHR MYENQSQVVL 1650
    VENLHVNKTN ETIRHENKPY VPSSAQMTRR KFQKAKPNLG RAHSKKEEPV 1700
    LEKVTTDQSK EGKPEDHLLQ KGASNTQLLL KEKAELLTSL EVSARKDCVG 1750
    SKESALAKID AELEEVGPSR RVGEETVGDN SPSSVVEEQY LNKLTSCPQP 1800
    LNETSYSKIA LDGKTTISST SEYERNRGER RSHKKFKPNV TRGRGSKRVR 1850
    GKTSKKEPRA SKAMLVTLRA SQEEDDDADD FESDYEEESY HLAPEEVNKA 1900
    PVFVPVGLRS PEPVSAQIEE TMEELEITVN VPDVGCIAVV EHELPNTDVT 1950
    TEEMKQEENL SVPFEMTTSE HIQDEPGTND GSTEAAITLL TMGDLVLQSE 2000
    ISSEQGDVGV CIIPHVHSKD KSHIPSSLDN VNHKIVHECQ ELSSPVITTS 2050
    PASFEENKIV LEEQSSREEI SLMEKVKENA TPTRNTISKV TSNLRIRSRL 2100
    AKPKPNLEKT LGTNRLDDYQ EVSSLCVTKG AEMETQRETE KNASKATELE 2150
    NKNLGPVTTA ENKDQSKLAC VHGIKGTSIS SEVNLTERNE NQEESSQEVH 2200
    MLSVAPVASS ETGPCTLGLD RGLGENSVEE PQIKDSKGDS VLTLPVPEYT 2250
    PTSIPEVQQE NIINPQDLTV NLVANVPQDG EDEQAFILTL VEIPANAVEE 2300
    FTDATAQFMP NPLLPAPILV KSVNTEERGD MSICLPATSV GQDAMGLSIS 2350
    GRDNSKKPPD NLDLVSRKRF QCRLDKNDHI PPAKKRSLTL RDDCQEYTTE 2400
    VHSKELTNVF EETGESHKGQ DIFLTSGSTL TTPEPQRQQV EAAFQSRGSR 2450
    SPDACMDKNV PQLPQDEMIV SDKEERTDAA PKSQQMDSRT SSSKASLSRP 2500
    GRRPLGFLSL ICSKNSLESD EPMQVHSKKR LKPLIPGLRK KLKRSNPFNE 2550
    SQEKNRESSD LLPSPSVITT QSENISSSAT QVSCDQPLLK EGYKSAQKRA 2600
    PQGEATTVSE YFFNDIFIEV DETE 2624
    Length:2,624
    Mass (Da):293,885
    Last modified:January 11, 2011 - v3
    Checksum:iCB7B80EBBF06B557
    GO
    Isoform 2 (identifier: A6H8Y1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2249-2254: YTPTSI → VKECTV
         2255-2624: Missing.

    Show »
    Length:2,254
    Mass (Da):252,841
    Checksum:i5028C313143A257A
    GO
    Isoform 3 (identifier: A6H8Y1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTLKNL
         1389-2624: Missing.

    Show »
    Length:1,388
    Mass (Da):156,401
    Checksum:iCA5A8B8025222C59
    GO
    Isoform 4 (identifier: A6H8Y1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1354-1372: NISSEVLSMMHTPVEEKRN → VCIFLSFKSFLNAFFRGNK
         1373-2624: Missing.

    Show »
    Length:1,372
    Mass (Da):154,704
    Checksum:iE9E1E54C426362F8
    GO
    Isoform 5 (identifier: A6H8Y1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-610: Missing.
         1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTFKNL
         1389-2624: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:778
    Mass (Da):87,789
    Checksum:iB0472F9FC6FB6897
    GO
    Isoform 6 (identifier: A6H8Y1-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-43: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,604
    Mass (Da):291,768
    Checksum:i006AAB63089EB64F
    GO
    Isoform 7 (identifier: A6H8Y1-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1977-2008: Missing.
         2582-2584: VSC → RPF
         2585-2624: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,552
    Mass (Da):286,185
    Checksum:iF159FF75502B6844
    GO
    Isoform 8 (identifier: A6H8Y1-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1863: Missing.
         2008-2008: Missing.
         2271-2327: NLVANVPQDG...ILVKSVNTEE → FVYQQLQLVK...FLLPKNVHSL
         2328-2624: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:463
    Mass (Da):51,420
    Checksum:i054AFA93526C7083
    GO

    Sequence cautioni

    The sequence AAH32146.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence AAG09268.1 differs from that shown. Reason: Frameshift at positions 837 and 863.
    The sequence BAA86555.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAB21780.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence CAH18085.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti8 – 81S → N in AAG09268. 1 PublicationCurated
    Sequence conflicti233 – 2331E → G in AAG30221. (PubMed:11040218)Curated
    Sequence conflicti233 – 2331E → G in AAG30220. (PubMed:11040218)Curated
    Sequence conflicti575 – 5751R → K in BAB71602. (PubMed:14702039)Curated
    Sequence conflicti683 – 6831V → D in CAC21448. (PubMed:11161782)Curated
    Sequence conflicti881 – 8811A → T in AAG09268. 1 PublicationCurated
    Sequence conflicti973 – 9731V → G in CAC21448. (PubMed:11161782)Curated
    Sequence conflicti973 – 9731V → G in CAC04245. (PubMed:11161782)Curated
    Sequence conflicti1009 – 10091E → G in AAG30221. (PubMed:11040218)Curated
    Sequence conflicti1009 – 10091E → G in AAG30220. (PubMed:11040218)Curated
    Sequence conflicti2580 – 25801T → A in CAE46010. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti26 – 261N → S.
    Corresponds to variant rs3748042 [ dbSNP | Ensembl ].
    VAR_056743
    Natural varianti38 – 381D → E.4 Publications
    Corresponds to variant rs3748043 [ dbSNP | Ensembl ].
    VAR_043312
    Natural varianti125 – 1251A → V.
    Corresponds to variant rs9687593 [ dbSNP | Ensembl ].
    VAR_056744
    Natural varianti722 – 7221K → E.
    Corresponds to variant rs36009281 [ dbSNP | Ensembl ].
    VAR_056745
    Natural varianti757 – 7571R → C.3 Publications
    Corresponds to variant rs3761966 [ dbSNP | Ensembl ].
    VAR_043313
    Natural varianti778 – 7781V → M.
    Corresponds to variant rs3761967 [ dbSNP | Ensembl ].
    VAR_043314
    Natural varianti1180 – 11801G → S.
    Corresponds to variant rs715748 [ dbSNP | Ensembl ].
    VAR_056746
    Natural varianti1244 – 12441F → I.2 Publications
    Corresponds to variant rs1961760 [ dbSNP | Ensembl ].
    VAR_056747
    Natural varianti1264 – 12641I → M.3 Publications
    Corresponds to variant rs715747 [ dbSNP | Ensembl ].
    VAR_043315
    Natural varianti1347 – 13471V → M.5 Publications
    Corresponds to variant rs6886336 [ dbSNP | Ensembl ].
    VAR_043316
    Natural varianti1469 – 14691K → E.2 Publications
    Corresponds to variant rs1698063 [ dbSNP | Ensembl ].
    VAR_043317
    Natural varianti1676 – 16761Q → E.
    Corresponds to variant rs12187098 [ dbSNP | Ensembl ].
    VAR_056748
    Natural varianti2013 – 20131I → L.2 Publications
    Corresponds to variant rs6453014 [ dbSNP | Ensembl ].
    VAR_043318
    Natural varianti2555 – 25551N → S.
    Corresponds to variant rs17276250 [ dbSNP | Ensembl ].
    VAR_056749

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 18631863Missing in isoform 8. 1 PublicationVSP_033567Add
    BLAST
    Alternative sequencei1 – 610610Missing in isoform 5. 1 PublicationVSP_033568Add
    BLAST
    Alternative sequencei24 – 4320Missing in isoform 6. 1 PublicationVSP_033569Add
    BLAST
    Alternative sequencei1354 – 138835NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTLKNL in isoform 3. 1 PublicationVSP_033570Add
    BLAST
    Alternative sequencei1354 – 138835NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTFKNL in isoform 5. 1 PublicationVSP_033571Add
    BLAST
    Alternative sequencei1354 – 137219NISSE…EEKRN → VCIFLSFKSFLNAFFRGNK in isoform 4. 1 PublicationVSP_033572Add
    BLAST
    Alternative sequencei1373 – 26241252Missing in isoform 4. 1 PublicationVSP_033573Add
    BLAST
    Alternative sequencei1389 – 26241236Missing in isoform 3 and isoform 5. 2 PublicationsVSP_033574Add
    BLAST
    Alternative sequencei1977 – 200832Missing in isoform 7. 1 PublicationVSP_033575Add
    BLAST
    Alternative sequencei2008 – 20081Missing in isoform 8. 1 PublicationVSP_033576
    Alternative sequencei2249 – 22546YTPTSI → VKECTV in isoform 2. 1 PublicationVSP_033577
    Alternative sequencei2255 – 2624370Missing in isoform 2. 1 PublicationVSP_033578Add
    BLAST
    Alternative sequencei2271 – 232757NLVAN…VNTEE → FVYQQLQLVKMPWVYLFLEE IILKSRLIIWILYLGRDFNA GLIKMTTFLLPKNVHSL in isoform 8. 1 PublicationVSP_033579Add
    BLAST
    Alternative sequencei2328 – 2624297Missing in isoform 8. 1 PublicationVSP_033580Add
    BLAST
    Alternative sequencei2582 – 25843VSC → RPF in isoform 7. 1 PublicationVSP_033581
    Alternative sequencei2585 – 262440Missing in isoform 7. 1 PublicationVSP_033582Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF298151 mRNA. Translation: AAG30220.1.
    AF298152 mRNA. Translation: AAG30221.1.
    AJ238520 mRNA. Translation: CAC04245.1.
    AJ278892 Genomic DNA. Translation: CAC17771.1.
    AJ279120
    , AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA. Translation: CAC21448.1.
    AB033067 mRNA. Translation: BAA86555.1. Different initiation.
    AB051476 mRNA. Translation: BAB21780.3. Different initiation.
    BX641011 mRNA. Translation: CAE46010.1.
    CR749229 mRNA. Translation: CAH18085.1. Different initiation.
    CR749289 mRNA. Translation: CAH18144.1.
    AC138832 Genomic DNA. No translation available.
    BC032146 mRNA. Translation: AAH32146.1. Sequence problems.
    BC146792 mRNA. Translation: AAI46793.1.
    AF176695 mRNA. Translation: AAG09268.1. Frameshift.
    AK057871 mRNA. Translation: BAB71602.1.
    CCDSiCCDS43328.1. [A6H8Y1-1]
    RefSeqiNP_060899.2. NM_018429.2. [A6H8Y1-1]
    UniGeneiHs.258272.

    Genome annotation databases

    EnsembliENST00000358731; ENSP00000351575; ENSG00000145734. [A6H8Y1-1]
    ENST00000380675; ENSP00000370050; ENSG00000145734. [A6H8Y1-8]
    GeneIDi55814.
    KEGGihsa:55814.
    UCSCiuc003kbn.1. human. [A6H8Y1-4]
    uc003kbo.3. human. [A6H8Y1-2]
    uc003kbp.1. human. [A6H8Y1-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF298151 mRNA. Translation: AAG30220.1 .
    AF298152 mRNA. Translation: AAG30221.1 .
    AJ238520 mRNA. Translation: CAC04245.1 .
    AJ278892 Genomic DNA. Translation: CAC17771.1 .
    AJ279120
    , AJ279121 , AJ279122 , AJ279123 , AJ279124 , AJ279125 , AJ279126 , AJ279127 , AJ279128 , AJ279129 , AJ279130 , AJ279131 , AJ279132 , AJ279133 , AJ279134 , AJ279135 , AJ279136 , AJ279137 , AJ279138 , AJ279139 , AJ279140 , AJ279141 , AJ279142 , AJ279143 , AJ279144 , AJ279145 , AJ279146 , AJ279147 , AJ279148 , AJ279149 , AJ279150 Genomic DNA. Translation: CAC21448.1 .
    AB033067 mRNA. Translation: BAA86555.1 . Different initiation.
    AB051476 mRNA. Translation: BAB21780.3 . Different initiation.
    BX641011 mRNA. Translation: CAE46010.1 .
    CR749229 mRNA. Translation: CAH18085.1 . Different initiation.
    CR749289 mRNA. Translation: CAH18144.1 .
    AC138832 Genomic DNA. No translation available.
    BC032146 mRNA. Translation: AAH32146.1 . Sequence problems.
    BC146792 mRNA. Translation: AAI46793.1 .
    AF176695 mRNA. Translation: AAG09268.1 . Frameshift.
    AK057871 mRNA. Translation: BAB71602.1 .
    CCDSi CCDS43328.1. [A6H8Y1-1 ]
    RefSeqi NP_060899.2. NM_018429.2. [A6H8Y1-1 ]
    UniGenei Hs.258272.

    3D structure databases

    ProteinModelPortali A6H8Y1.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120924. 1 interaction.
    IntActi A6H8Y1. 1 interaction.
    MINTi MINT-5003529.

    PTM databases

    PhosphoSitei A6H8Y1.

    Proteomic databases

    MaxQBi A6H8Y1.
    PaxDbi A6H8Y1.
    PRIDEi A6H8Y1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358731 ; ENSP00000351575 ; ENSG00000145734 . [A6H8Y1-1 ]
    ENST00000380675 ; ENSP00000370050 ; ENSG00000145734 . [A6H8Y1-8 ]
    GeneIDi 55814.
    KEGGi hsa:55814.
    UCSCi uc003kbn.1. human. [A6H8Y1-4 ]
    uc003kbo.3. human. [A6H8Y1-2 ]
    uc003kbp.1. human. [A6H8Y1-1 ]

    Organism-specific databases

    CTDi 55814.
    GeneCardsi GC05P070787.
    H-InvDB HIX0004927.
    HGNCi HGNC:13652. BDP1.
    HPAi HPA043140.
    HPA049726.
    MIMi 607012. gene.
    neXtProti NX_A6H8Y1.
    PharmGKBi PA25336.
    HUGEi Search...
    Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5118.
    HOVERGENi HBG107497.
    InParanoidi A6H8Y1.
    KOi K15198.
    OMAi KPNIGRG.
    PhylomeDBi A6H8Y1.
    TreeFami TF328878.

    Enzyme and pathway databases

    Reactomei REACT_1036. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
    REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
    REACT_347. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
    REACT_571. RNA Polymerase III Transcription Initiation From Type 3 Promoter.
    SignaLinki A6H8Y1.

    Miscellaneous databases

    ChiTaRSi BDP1. human.
    GeneWikii BDP1.
    GenomeRNAii 55814.
    NextBioi 60990.
    PROi A6H8Y1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi A6H8Y1.
    Bgeei A6H8Y1.
    CleanExi HS_BDP1.
    Genevestigatori A6H8Y1.

    Family and domain databases

    InterProi IPR009057. Homeodomain-like.
    IPR001005. SANT/Myb.
    [Graphical view ]
    SMARTi SM00717. SANT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Different human TFIIIB activities direct RNA polymerase III transcription from TATA-containing and TATA-less promoters."
      Schramm L., Pendergrast P.S., Sun Y., Hernandez N.
      Genes Dev. 14:2650-2663(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, VARIANTS GLU-38 AND MET-1347.
    2. "The transcription factor-like nuclear regulator (TFNR) contains a novel 55-amino-acid motif repeated nine times and maps closely to SMN1."
      Kelter A.R., Herchenbach J., Wirth B.
      Genomics 70:315-326(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-2187 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2189-2624 (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS GLU-38; MET-1347 AND LEU-2013.
    3. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
      DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANTS CYS-757; MET-1264 AND MET-1347.
      Tissue: Brain.
    4. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
      DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469.
      Tissue: Brain.
    5. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1947-2624 (ISOFORM 7), VARIANT LEU-2013.
      Tissue: Testis.
    7. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469.
      Tissue: Lung.
    9. "Molecular cloning and functional characterization of human TFIIIB 150."
      Teichmann M., Wang Z., Ito M., Seifart K.H., Roeder R.G.
      Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-881 (ISOFORM 1).
    10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-655 (ISOFORM 6).
      Tissue: Brain.
    11. "A stable complex of a novel transcription factor IIB- related factor, human TFIIIB50, and associated proteins mediate selective transcription by RNA polymerase III of genes with upstream promoter elements."
      Teichmann M., Wang Z., Roeder R.G.
      Proc. Natl. Acad. Sci. U.S.A. 97:14200-14205(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION OF TFIIIB-ALPHA COMPLEX.
    12. "TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo."
      Fairley J.A., Scott P.H., White R.J.
      EMBO J. 22:5841-5850(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH BRF1.
    13. "Transcription factor (TF)-like nuclear regulator, the 250-kDa form of Homo sapiens TFIIIB', is an essential component of human TFIIIC1 activity."
      Weser S., Gruber C., Hafner H.M., Teichmann M., Roeder R.G., Seifart K.H., Meissner W.
      J. Biol. Chem. 279:27022-27029(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION OF TFIIIC1 COMPLEX.
    14. "CK2 phosphorylation of Bdp1 executes cell cycle-specific RNA polymerase III transcription repression."
      Hu P., Samudre K., Wu S., Sun Y., Hernandez N.
      Mol. Cell 16:81-92(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION, MUTAGENESIS OF SER-390; SER-426; SER-431; THR-437 AND SER-446.
    15. "The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB."
      Schoenen F., Wirth B.
      Biol. Chem. 387:277-284(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ZBTB43.
    16. "A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes."
      Emran F., Florens L., Ma B., Swanson S.K., Washburn M.P., Hernandez N.
      Gene 377:96-108(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT.
    17. "Epstein-Barr virus induces cellular transcription factors to allow active expression of EBER genes by RNA polymerase III."
      Felton-Edkins Z.A., Kondrashov A., Karali D., Fairley J.A., Dawson C.W., Arrand J.R., Young L.S., White R.J.
      J. Biol. Chem. 281:33871-33880(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    18. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiBDP1_HUMAN
    AccessioniPrimary (citable) accession number: A6H8Y1
    Secondary accession number(s): Q68DS6
    , Q68DY5, Q6MZL9, Q6PIM7, Q86W98, Q96LR8, Q9C0H4, Q9H197, Q9H1A1, Q9HAW1, Q9HAW2, Q9HCY0, Q9ULH9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 20, 2008
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 68 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3