Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A6H8Y1 (BDP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 63. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transcription factor TFIIIB component B'' homolog
Alternative name(s):
Transcription factor IIIB 150
Short name=TFIIIB150
Transcription factor-like nuclear regulator
Gene names
Name:BDP1
Synonyms:KIAA1241, KIAA1689, TFNR
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2624 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

General activator of RNA polymerase III transcription. Requires for transcription from all three types of polymerase III promoters. Requires for transcription of genes with internal promoter elements and with promoter elements upstream of the initiation site. Ref.1

Subunit structure

Component of TFIIIB complex. The TFIIIB complex has two activities, alpha and beta. The TFIIIB-alpha and TFIIIB-beta activities are required for transcription of genes with TFIIIC-bound internal promoters and PSE transcription factor-bound external promoters, respectively. The TFIIIB-alpha activity complex is composed of TBP, BDP1, and a complex containing both BRF2 and at least four stably associated proteins; YY1 facilitates the formation of TFIIIB-alpha activity complex. The TFIIIB-beta activity complex is composed of TBP, BDP1, and BRF1. Interacts with BRF1; this interaction diminishes during mitosis resulting in the release of BDP1 from chromosomal templates. Component of TFIIIC complex. The TFIIIC complex has two activities, C1 and C2. The TFIIIC2 activity complex is only required for transcription of the 'classical' pol III genes whereas the TFIIIC1 activity complex is required for transcription of all pol III genes. The TFIIIC1 activity complex is composed at least of BDP1. Interacts with ZBTB43. Ref.12 Ref.15 Ref.16

Subcellular location

Nucleus Ref.2.

Tissue specificity

Isoform 2 is highly expressed in cerebellum. Ref.2

Induction

By Epstein-Barr virus (EBV) resulting in the stimulation of the EBV EBER genes. Ref.17

Post-translational modification

Phosphorylated by CSNK2A1 during mitosis, resulting in its release from chromatin and suppression of polymerase III transcription. Ref.14

Sequence similarities

Contains 1 Myb-like domain.

Sequence caution

The sequence AAG09268.1 differs from that shown. Reason: Frameshift at positions 837 and 863.

The sequence AAH32146.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence BAA86555.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAB21780.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence CAH18085.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
Repeat
   Molecular functionActivator
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processgene expression

Traceable author statement. Source: Reactome

regulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription from RNA polymerase III promoter

Traceable author statement. Source: Reactome

   Cellular_componentcytoplasm

Inferred from direct assay. Source: HPA

nucleoplasm

Traceable author statement. Source: Reactome

nucleus

Inferred from direct assay. Source: HPA

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: InterPro

chromatin binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A6H8Y1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A6H8Y1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2249-2254: YTPTSI → VKECTV
     2255-2624: Missing.
Isoform 3 (identifier: A6H8Y1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTLKNL
     1389-2624: Missing.
Isoform 4 (identifier: A6H8Y1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1372: NISSEVLSMMHTPVEEKRN → VCIFLSFKSFLNAFFRGNK
     1373-2624: Missing.
Isoform 5 (identifier: A6H8Y1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-610: Missing.
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTFKNL
     1389-2624: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: A6H8Y1-6)

The sequence of this isoform differs from the canonical sequence as follows:
     24-43: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: A6H8Y1-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1977-2008: Missing.
     2582-2584: VSC → RPF
     2585-2624: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: A6H8Y1-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1863: Missing.
     2008-2008: Missing.
     2271-2327: NLVANVPQDG...ILVKSVNTEE → FVYQQLQLVK...FLLPKNVHSL
     2328-2624: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 26242624Transcription factor TFIIIB component B'' homolog
PRO_0000333863

Regions

Domain295 – 34551Myb-like
Repeat823 – 877551; approximate
Repeat878 – 932552
Repeat933 – 987553
Repeat988 – 1040534
Repeat1041 – 1094545
Repeat1095 – 1148546
Repeat1149 – 1203557
Repeat1204 – 1257548; approximate
Repeat1258 – 1327709; approximate
Region1 – 299299Interaction with ZBTB43
Region355 – 470116Required for phosphorylation by CSNK2A1
Region823 – 13275059 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-T
Coiled coil144 – 17734 Potential
Coiled coil1078 – 110326 Potential
Coiled coil1223 – 128462 Potential
Compositional bias84 – 11936Ser-rich

Amino acid modifications

Modified residue9151Phosphothreonine Ref.18

Natural variations

Alternative sequence1 – 18631863Missing in isoform 8.
VSP_033567
Alternative sequence1 – 610610Missing in isoform 5.
VSP_033568
Alternative sequence24 – 4320Missing in isoform 6.
VSP_033569
Alternative sequence1354 – 138835NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTLKNL in isoform 3.
VSP_033570
Alternative sequence1354 – 138835NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTFKNL in isoform 5.
VSP_033571
Alternative sequence1354 – 137219NISSE…EEKRN → VCIFLSFKSFLNAFFRGNK in isoform 4.
VSP_033572
Alternative sequence1373 – 26241252Missing in isoform 4.
VSP_033573
Alternative sequence1389 – 26241236Missing in isoform 3 and isoform 5.
VSP_033574
Alternative sequence1977 – 200832Missing in isoform 7.
VSP_033575
Alternative sequence20081Missing in isoform 8.
VSP_033576
Alternative sequence2249 – 22546YTPTSI → VKECTV in isoform 2.
VSP_033577
Alternative sequence2255 – 2624370Missing in isoform 2.
VSP_033578
Alternative sequence2271 – 232757NLVAN…VNTEE → FVYQQLQLVKMPWVYLFLEE IILKSRLIIWILYLGRDFNA GLIKMTTFLLPKNVHSL in isoform 8.
VSP_033579
Alternative sequence2328 – 2624297Missing in isoform 8.
VSP_033580
Alternative sequence2582 – 25843VSC → RPF in isoform 7.
VSP_033581
Alternative sequence2585 – 262440Missing in isoform 7.
VSP_033582
Natural variant261N → S.
Corresponds to variant rs3748042 [ dbSNP | Ensembl ].
VAR_056743
Natural variant381D → E. Ref.1 Ref.2 Ref.4 Ref.8
Corresponds to variant rs3748043 [ dbSNP | Ensembl ].
VAR_043312
Natural variant1251A → V.
Corresponds to variant rs9687593 [ dbSNP | Ensembl ].
VAR_056744
Natural variant7221K → E.
Corresponds to variant rs36009281 [ dbSNP | Ensembl ].
VAR_056745
Natural variant7571R → C. Ref.3 Ref.4 Ref.8
Corresponds to variant rs3761966 [ dbSNP | Ensembl ].
VAR_043313
Natural variant7781V → M.
Corresponds to variant rs3761967 [ dbSNP | Ensembl ].
VAR_043314
Natural variant11801G → S.
Corresponds to variant rs715748 [ dbSNP | Ensembl ].
VAR_056746
Natural variant12441F → I. Ref.4 Ref.8
Corresponds to variant rs1961760 [ dbSNP | Ensembl ].
VAR_056747
Natural variant12641I → M. Ref.3 Ref.4 Ref.8
Corresponds to variant rs715747 [ dbSNP | Ensembl ].
VAR_043315
Natural variant13471V → M. Ref.1 Ref.2 Ref.3 Ref.4 Ref.8
Corresponds to variant rs6886336 [ dbSNP | Ensembl ].
VAR_043316
Natural variant14691K → E. Ref.4 Ref.8
Corresponds to variant rs1698063 [ dbSNP | Ensembl ].
VAR_043317
Natural variant16761Q → E.
Corresponds to variant rs12187098 [ dbSNP | Ensembl ].
VAR_056748
Natural variant20131I → L. Ref.2 Ref.6
Corresponds to variant rs6453014 [ dbSNP | Ensembl ].
VAR_043318
Natural variant25551N → S.
Corresponds to variant rs17276250 [ dbSNP | Ensembl ].
VAR_056749

Experimental info

Mutagenesis3901S → A: Not phosphorylated by CSNK2A1; when associated with A-426; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-426; A-431; A-437 and A-446. Ref.14
Mutagenesis4261S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-431; A-437 and A-446. Ref.14
Mutagenesis4311S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-437 and A-446. Ref.14
Mutagenesis4371T → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-446. Ref.14
Mutagenesis4461S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-437. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-437. Ref.14
Sequence conflict81S → N in AAG09268. Ref.9
Sequence conflict2331E → G in AAG30221. Ref.1
Sequence conflict2331E → G in AAG30220. Ref.1
Sequence conflict5751R → K in BAB71602. Ref.10
Sequence conflict6831V → D in CAC21448. Ref.2
Sequence conflict8811A → T in AAG09268. Ref.9
Sequence conflict9731V → G in CAC21448. Ref.2
Sequence conflict9731V → G in CAC04245. Ref.2
Sequence conflict10091E → G in AAG30221. Ref.1
Sequence conflict10091E → G in AAG30220. Ref.1
Sequence conflict25801T → A in CAE46010. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 11, 2011. Version 3.
Checksum: CB7B80EBBF06B557

FASTA2,624293,885
        10         20         30         40         50         60 
MFRRARLSVK PNVRPGVGAR GSTASNPQRG RESPRPPDPA TDSASKPAEP TDVPTVDFGG 

        70         80         90        100        110        120 
AEPQEKAPRS STEKTGGDND VEESSRSSST VSQRRKRISS TSSLVKSSVS VPSESHPLST 

       130        140        150        160        170        180 
INQEAPQPTA TSTKEKQPCS DRYRIYKAQK LREMLKEELR KEKKQWKNKY AINESQRPPD 

       190        200        210        220        230        240 
RSKMTMRDFI YYLPDNNPMT SSLEQEKKTE KPSTPVQTRE QEGKSTPNAE DNEMEEETDD 

       250        260        270        280        290        300 
GPLLVPRVKV AEDGSIILDE ESLTVEVLRT KGPCVVEEND PIFERGSTTT YSSFRKNYYS 

       310        320        330        340        350        360 
KPWSNKETDM FFLAISMVGT DFSMIGQLFP HRARIEIKNK FKREEKTNGW RIDKAFQEKR 

       370        380        390        400        410        420 
PFDFDFFAHL LQKVLAEEEK RKQKSVKNHS LKEKKSTKPR KNVKVKKVAC EGVNNDPDES 

       430        440        450        460        470        480 
MSSRISDTER SQKDAQTVEE ESLTLSREDA EQVALEVDLN QKKRRRKKQD GANELGVNNL 

       490        500        510        520        530        540 
LENATVQAGP SKGEKHKNKC QAIRPELKEG ECSKEQMLSC TQNIDGIVGF ASTEKVEKRT 

       550        560        570        580        590        600 
DPILSLSNQQ DATSVATESS ESSTSDLPSF EVGIRALCEV NNAEGSCIEE RNVDLKNNSL 

       610        620        630        640        650        660 
EIDQTENVKP MLRGRFQRPK PNLSRAGKKS VLSQGKTESE SKNSHSKTSV EKNHVEKDKM 

       670        680        690        700        710        720 
NTLDILRMET TERENPEAET VSVLGEKNCL QEGSQLKALR PVQVRGRLQK PKPNAGKAAE 

       730        740        750        760        770        780 
RKEILISQEE IGANVEKNEN ESCADRDTPQ HMEDQSRKDF EEEDVILQPE KNDSFQNVQP 

       790        800        810        820        830        840 
DEPKVLNECL SVQENNKANK LNQVPILRTR FQKPKPNIGR GTGRREISSK EEVLEKILVS 

       850        860        870        880        890        900 
GEMAAALRET VRLDTSPKEM VPAEINTKEM QSDLKETGRR AISPREKILD VIDDTIEMET 

       910        920        930        940        950        960 
GLKAMGREIC LREKTPEVID ATEEIDKDLE EAGRREISPQ KNGPEEVKPL GEVETDLKAT 

       970        980        990       1000       1010       1020 
GNESSPREKT PEVTDATEEI DKNLEETGRR KISPRENGPE EVKPVDEMET DLNATGRESS 

      1030       1040       1050       1060       1070       1080 
PREKTPEVID ATEEIDLEET EREVSPQENG LEEVKPLGEM ETDLKATGRD SFPRGKTPEV 

      1090       1100       1110       1120       1130       1140 
IDAIEEIEID LEETEREISP QENGLEEVKP LGEMQTDLKA TGREISPREK TPEVIDATEE 

      1150       1160       1170       1180       1190       1200 
IDKDLEETGR REISPEENGP EEVKPVDEME TDLKTTGREG SSREKTREVI DAAEVIETDL 

      1210       1220       1230       1240       1250       1260 
EETEREISPQ ENGPEEVKPV GKMETDLKEI REEISQREKV LAEFSAIREK EIDLKETGKR 

      1270       1280       1290       1300       1310       1320 
DIPIMEKVSG KMAVVEEMEA DLKETGKENF RERGSEEICV TEEKVAELKQ TGKTDISPRE 

      1330       1340       1350       1360       1370       1380 
NELEETSTSR QTDTHLMQSG SNDFSAVPSL DIQNISSEVL SMMHTPVEEK RNSEKEVSSH 

      1390       1400       1410       1420       1430       1440 
FSHFKISSQT HESDKTEVQG IQSPDVPEQF SDINLSKSLP QEQKPLEIKP APFVRSRFKR 

      1450       1460       1470       1480       1490       1500 
PKPNLARAAL KRETTESEKY IYEKKSETKK METIVMQENN EQTDTLPSQH DEASLMISRE 

      1510       1520       1530       1540       1550       1560 
KDTLGHRNEE AVILPCTQTE RNLSPSNSCE PKEESQSAPV QKNDSVVSVG TNNVNTFQQE 

      1570       1580       1590       1600       1610       1620 
MKESVIQTAR QVRGRLQRPR PNIRKTGQRQ IVDKGEAKGI IKEGRTILPK DETEKKVLTV 

      1630       1640       1650       1660       1670       1680 
SNSQIETEIE VPSSAVPEHR MYENQSQVVL VENLHVNKTN ETIRHENKPY VPSSAQMTRR 

      1690       1700       1710       1720       1730       1740 
KFQKAKPNLG RAHSKKEEPV LEKVTTDQSK EGKPEDHLLQ KGASNTQLLL KEKAELLTSL 

      1750       1760       1770       1780       1790       1800 
EVSARKDCVG SKESALAKID AELEEVGPSR RVGEETVGDN SPSSVVEEQY LNKLTSCPQP 

      1810       1820       1830       1840       1850       1860 
LNETSYSKIA LDGKTTISST SEYERNRGER RSHKKFKPNV TRGRGSKRVR GKTSKKEPRA 

      1870       1880       1890       1900       1910       1920 
SKAMLVTLRA SQEEDDDADD FESDYEEESY HLAPEEVNKA PVFVPVGLRS PEPVSAQIEE 

      1930       1940       1950       1960       1970       1980 
TMEELEITVN VPDVGCIAVV EHELPNTDVT TEEMKQEENL SVPFEMTTSE HIQDEPGTND 

      1990       2000       2010       2020       2030       2040 
GSTEAAITLL TMGDLVLQSE ISSEQGDVGV CIIPHVHSKD KSHIPSSLDN VNHKIVHECQ 

      2050       2060       2070       2080       2090       2100 
ELSSPVITTS PASFEENKIV LEEQSSREEI SLMEKVKENA TPTRNTISKV TSNLRIRSRL 

      2110       2120       2130       2140       2150       2160 
AKPKPNLEKT LGTNRLDDYQ EVSSLCVTKG AEMETQRETE KNASKATELE NKNLGPVTTA 

      2170       2180       2190       2200       2210       2220 
ENKDQSKLAC VHGIKGTSIS SEVNLTERNE NQEESSQEVH MLSVAPVASS ETGPCTLGLD 

      2230       2240       2250       2260       2270       2280 
RGLGENSVEE PQIKDSKGDS VLTLPVPEYT PTSIPEVQQE NIINPQDLTV NLVANVPQDG 

      2290       2300       2310       2320       2330       2340 
EDEQAFILTL VEIPANAVEE FTDATAQFMP NPLLPAPILV KSVNTEERGD MSICLPATSV 

      2350       2360       2370       2380       2390       2400 
GQDAMGLSIS GRDNSKKPPD NLDLVSRKRF QCRLDKNDHI PPAKKRSLTL RDDCQEYTTE 

      2410       2420       2430       2440       2450       2460 
VHSKELTNVF EETGESHKGQ DIFLTSGSTL TTPEPQRQQV EAAFQSRGSR SPDACMDKNV 

      2470       2480       2490       2500       2510       2520 
PQLPQDEMIV SDKEERTDAA PKSQQMDSRT SSSKASLSRP GRRPLGFLSL ICSKNSLESD 

      2530       2540       2550       2560       2570       2580 
EPMQVHSKKR LKPLIPGLRK KLKRSNPFNE SQEKNRESSD LLPSPSVITT QSENISSSAT 

      2590       2600       2610       2620 
QVSCDQPLLK EGYKSAQKRA PQGEATTVSE YFFNDIFIEV DETE 

« Hide

Isoform 2 [UniParc].

Checksum: 5028C313143A257A
Show »

FASTA2,254252,841
Isoform 3 [UniParc].

Checksum: CA5A8B8025222C59
Show »

FASTA1,388156,401
Isoform 4 [UniParc].

Checksum: E9E1E54C426362F8
Show »

FASTA1,372154,704
Isoform 5 [UniParc].

Checksum: B0472F9FC6FB6897
Show »

FASTA77887,789
Isoform 6 [UniParc].

Checksum: 006AAB63089EB64F
Show »

FASTA2,604291,768
Isoform 7 [UniParc].

Checksum: F159FF75502B6844
Show »

FASTA2,552286,185
Isoform 8 [UniParc].

Checksum: 054AFA93526C7083
Show »

FASTA46351,420

References

« Hide 'large scale' references
[1]"Different human TFIIIB activities direct RNA polymerase III transcription from TATA-containing and TATA-less promoters."
Schramm L., Pendergrast P.S., Sun Y., Hernandez N.
Genes Dev. 14:2650-2663(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, VARIANTS GLU-38 AND MET-1347.
[2]"The transcription factor-like nuclear regulator (TFNR) contains a novel 55-amino-acid motif repeated nine times and maps closely to SMN1."
Kelter A.R., Herchenbach J., Wirth B.
Genomics 70:315-326(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-2187 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2189-2624 (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS GLU-38; MET-1347 AND LEU-2013.
[3]"Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANTS CYS-757; MET-1264 AND MET-1347.
Tissue: Brain.
[4]"Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469.
Tissue: Brain.
[5]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1947-2624 (ISOFORM 7), VARIANT LEU-2013.
Tissue: Testis.
[7]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469.
Tissue: Lung.
[9]"Molecular cloning and functional characterization of human TFIIIB 150."
Teichmann M., Wang Z., Ito M., Seifart K.H., Roeder R.G.
Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-881 (ISOFORM 1).
[10]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-655 (ISOFORM 6).
Tissue: Brain.
[11]"A stable complex of a novel transcription factor IIB- related factor, human TFIIIB50, and associated proteins mediate selective transcription by RNA polymerase III of genes with upstream promoter elements."
Teichmann M., Wang Z., Roeder R.G.
Proc. Natl. Acad. Sci. U.S.A. 97:14200-14205(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION OF TFIIIB-ALPHA COMPLEX.
[12]"TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo."
Fairley J.A., Scott P.H., White R.J.
EMBO J. 22:5841-5850(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH BRF1.
[13]"Transcription factor (TF)-like nuclear regulator, the 250-kDa form of Homo sapiens TFIIIB', is an essential component of human TFIIIC1 activity."
Weser S., Gruber C., Hafner H.M., Teichmann M., Roeder R.G., Seifart K.H., Meissner W.
J. Biol. Chem. 279:27022-27029(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION OF TFIIIC1 COMPLEX.
[14]"CK2 phosphorylation of Bdp1 executes cell cycle-specific RNA polymerase III transcription repression."
Hu P., Samudre K., Wu S., Sun Y., Hernandez N.
Mol. Cell 16:81-92(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION, MUTAGENESIS OF SER-390; SER-426; SER-431; THR-437 AND SER-446.
[15]"The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB."
Schoenen F., Wirth B.
Biol. Chem. 387:277-284(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ZBTB43.
[16]"A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes."
Emran F., Florens L., Ma B., Swanson S.K., Washburn M.P., Hernandez N.
Gene 377:96-108(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT.
[17]"Epstein-Barr virus induces cellular transcription factors to allow active expression of EBER genes by RNA polymerase III."
Felton-Edkins Z.A., Kondrashov A., Karali D., Fairley J.A., Dawson C.W., Arrand J.R., Young L.S., White R.J.
J. Biol. Chem. 281:33871-33880(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
[18]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF298151 mRNA. Translation: AAG30220.1.
AF298152 mRNA. Translation: AAG30221.1.
AJ238520 mRNA. Translation: CAC04245.1.
AJ278892 Genomic DNA. Translation: CAC17771.1.
AJ279120 expand/collapse EMBL AC list , AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA. Translation: CAC21448.1.
AB033067 mRNA. Translation: BAA86555.1. Different initiation.
AB051476 mRNA. Translation: BAB21780.3. Different initiation.
BX641011 mRNA. Translation: CAE46010.1.
CR749229 mRNA. Translation: CAH18085.1. Different initiation.
CR749289 mRNA. Translation: CAH18144.1.
AC138832 Genomic DNA. No translation available.
BC032146 mRNA. Translation: AAH32146.1. Sequence problems.
BC146792 mRNA. Translation: AAI46793.1.
AF176695 mRNA. Translation: AAG09268.1. Frameshift.
AK057871 mRNA. Translation: BAB71602.1.
RefSeqNP_060899.2. NM_018429.2.
UniGeneHs.258272.

3D structure databases

ProteinModelPortalA6H8Y1.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120924. 1 interaction.
IntActA6H8Y1. 1 interaction.
MINTMINT-5003529.

PTM databases

PhosphoSiteA6H8Y1.

Proteomic databases

PaxDbA6H8Y1.
PRIDEA6H8Y1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000358731; ENSP00000351575; ENSG00000145734. [A6H8Y1-1]
ENST00000380675; ENSP00000370050; ENSG00000145734. [A6H8Y1-8]
ENST00000573110; ENSP00000460502; ENSG00000261932. [A6H8Y1-1]
GeneID55814.
KEGGhsa:55814.
UCSCuc003kbn.1. human. [A6H8Y1-4]
uc003kbo.3. human. [A6H8Y1-2]
uc003kbp.1. human. [A6H8Y1-1]

Organism-specific databases

CTD55814.
GeneCardsGC05P070787.
H-InvDBHIX0004927.
HGNCHGNC:13652. BDP1.
HPAHPA043140.
HPA049726.
MIM607012. gene.
neXtProtNX_A6H8Y1.
PharmGKBPA25336.
HUGESearch...
Search...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5118.
HOVERGENHBG107497.
InParanoidA6H8Y1.
KOK15198.
OMAKPNIGRG.
PhylomeDBA6H8Y1.
TreeFamTF328878.

Enzyme and pathway databases

ReactomeREACT_1788. Transcription.
REACT_71. Gene Expression.
SignaLinkA6H8Y1.

Gene expression databases

ArrayExpressA6H8Y1.
BgeeA6H8Y1.
CleanExHS_BDP1.
GenevestigatorA6H8Y1.

Family and domain databases

InterProIPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
[Graphical view]
SMARTSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 1 hit.
ProtoNetSearch...

Other

ChiTaRSBDP1. human.
GeneWikiBDP1.
GenomeRNAi55814.
NextBio60990.
PROA6H8Y1.
SOURCESearch...

Entry information

Entry nameBDP1_HUMAN
AccessionPrimary (citable) accession number: A6H8Y1
Secondary accession number(s): Q68DS6 expand/collapse secondary AC list , Q68DY5, Q6MZL9, Q6PIM7, Q86W98, Q96LR8, Q9C0H4, Q9H197, Q9H1A1, Q9HAW1, Q9HAW2, Q9HCY0, Q9ULH9
Entry history
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: January 11, 2011
Last modified: April 16, 2014
This is version 63 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM