A6H8Y1 (BDP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 56.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor TFIIIB component B'' homolog Alternative name(s): Transcription factor IIIB 150 Short name=TFIIIB150 Transcription factor-like nuclear regulator | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2624 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | General activator of RNA polymerase III transcription. Requires for transcription from all three types of polymerase III promoters. Requires for transcription of genes with internal promoter elements and with promoter elements upstream of the initiation site. Ref.1 |
| Subunit structure | Component of TFIIIB complex. The TFIIIB complex has two activities, alpha and beta. The TFIIIB-alpha and TFIIIB-beta activities are required for transcription of genes with TFIIIC-bound internal promoters and PSE transcription factor-bound external promoters, respectively. The TFIIIB-alpha activity complex is composed of TBP, BDP1, and a complex containing both BRF2 and at least four stably associated proteins; YY1 facilitates the formation of TFIIIB-alpha activity complex. The TFIIIB-beta activity complex is composed of TBP, BDP1, and BRF1. Interacts with BRF1; this interaction diminishes during mitosis resulting in the release of BDP1 from chromosomal templates. Component of TFIIIC complex. The TFIIIC complex has two activities, C1 and C2. The TFIIIC2 activity complex is only required for transcription of the 'classical' pol III genes whereas the TFIIIC1 activity complex is required for transcription of all pol III genes. The TFIIIC1 activity complex is composed at least of BDP1. Interacts with ZBTB43. Ref.12 Ref.15 Ref.16 |
| Subcellular location | |
| Tissue specificity | |
| Induction | By Epstein-Barr virus (EBV) resulting in the stimulation of the EBV EBER genes. Ref.17 |
| Post-translational modification | Phosphorylated by CSNK2A1 during mitosis, resulting in its release from chromatin and suppression of polymerase III transcription. Ref.14 |
| Sequence similarities | Contains 1 Myb-like domain. |
| Sequence caution | The sequence AAG09268.1 differs from that shown. Reason: Frameshift at positions 837 and 863. The sequence AAH32146.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence BAA86555.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB21780.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAH18085.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Repeat |
| Molecular function | Activator |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription from RNA polymerase III promoterTraceable author statement. Source: Reactome |
| Cellular_component | nucleoplasm Traceable author statement. Source: Reactome |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: InterPro chromatin bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A6H8Y1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A6H8Y1-2) The sequence of this isoform differs from the canonical sequence as follows: 2249-2254: YTPTSI → VKECTV 2255-2624: Missing. | ||||||
| Isoform 3 (identifier: A6H8Y1-3) The sequence of this isoform differs from the canonical sequence as follows: 1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTLKNL 1389-2624: Missing. | ||||||
| Isoform 4 (identifier: A6H8Y1-4) The sequence of this isoform differs from the canonical sequence as follows: 1354-1372: NISSEVLSMMHTPVEEKRN → VCIFLSFKSFLNAFFRGNK 1373-2624: Missing. | ||||||
| Isoform 5 (identifier: A6H8Y1-5) The sequence of this isoform differs from the canonical sequence as follows: 1-610: Missing. 1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTFKNL 1389-2624: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: A6H8Y1-6) The sequence of this isoform differs from the canonical sequence as follows: 24-43: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: A6H8Y1-7) The sequence of this isoform differs from the canonical sequence as follows: 1977-2008: Missing. 2582-2584: VSC → RPF 2585-2624: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: A6H8Y1-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1863: Missing. 2008-2008: Missing. 2271-2327: NLVANVPQDG...ILVKSVNTEE → FVYQQLQLVK...FLLPKNVHSL 2328-2624: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2624 | 2624 | Transcription factor TFIIIB component B'' homolog | PRO_0000333863 | |||||
Regions | |||||||||
| Domain | 295 – 345 | 51 | Myb-like | ||||||
| Repeat | 823 – 877 | 55 | 1; approximate | ||||||
| Repeat | 878 – 932 | 55 | 2 | ||||||
| Repeat | 933 – 987 | 55 | 3 | ||||||
| Repeat | 988 – 1040 | 53 | 4 | ||||||
| Repeat | 1041 – 1094 | 54 | 5 | ||||||
| Repeat | 1095 – 1148 | 54 | 6 | ||||||
| Repeat | 1149 – 1203 | 55 | 7 | ||||||
| Repeat | 1204 – 1257 | 54 | 8; approximate | ||||||
| Repeat | 1258 – 1327 | 70 | 9; approximate | ||||||
| Region | 1 – 299 | 299 | Interaction with ZBTB43 | ||||||
| Region | 355 – 470 | 116 | Required for phosphorylation by CSNK2A1 | ||||||
| Region | 823 – 1327 | 505 | 9 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-T | ||||||
| Coiled coil | 144 – 177 | 34 | Potential | ||||||
| Coiled coil | 1078 – 1103 | 26 | Potential | ||||||
| Coiled coil | 1223 – 1284 | 62 | Potential | ||||||
| Compositional bias | 84 – 119 | 36 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 915 | 1 | Phosphothreonine Ref.18 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 1863 | 1863 | Missing in isoform 8. | VSP_033567 | |||||
| Alternative sequence | 1 – 610 | 610 | Missing in isoform 5. | VSP_033568 | |||||
| Alternative sequence | 24 – 43 | 20 | Missing in isoform 6. | VSP_033569 | |||||
| Alternative sequence | 1354 – 1388 | 35 | NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTLKNL in isoform 3. | VSP_033570 | |||||
| Alternative sequence | 1354 – 1388 | 35 | NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTFKNL in isoform 5. | VSP_033571 | |||||
| Alternative sequence | 1354 – 1372 | 19 | NISSE…EEKRN → VCIFLSFKSFLNAFFRGNK in isoform 4. | VSP_033572 | |||||
| Alternative sequence | 1373 – 2624 | 1252 | Missing in isoform 4. | VSP_033573 | |||||
| Alternative sequence | 1389 – 2624 | 1236 | Missing in isoform 3 and isoform 5. | VSP_033574 | |||||
| Alternative sequence | 1977 – 2008 | 32 | Missing in isoform 7. | VSP_033575 | |||||
| Alternative sequence | 2008 | 1 | Missing in isoform 8. | VSP_033576 | |||||
| Alternative sequence | 2249 – 2254 | 6 | YTPTSI → VKECTV in isoform 2. | VSP_033577 | |||||
| Alternative sequence | 2255 – 2624 | 370 | Missing in isoform 2. | VSP_033578 | |||||
| Alternative sequence | 2271 – 2327 | 57 | NLVAN…VNTEE → FVYQQLQLVKMPWVYLFLEE IILKSRLIIWILYLGRDFNA GLIKMTTFLLPKNVHSL in isoform 8. | VSP_033579 | |||||
| Alternative sequence | 2328 – 2624 | 297 | Missing in isoform 8. | VSP_033580 | |||||
| Alternative sequence | 2582 – 2584 | 3 | VSC → RPF in isoform 7. | VSP_033581 | |||||
| Alternative sequence | 2585 – 2624 | 40 | Missing in isoform 7. | VSP_033582 | |||||
| Natural variant | 26 | 1 | N → S. Corresponds to variant rs3748042 [ dbSNP | Ensembl ]. | VAR_056743 | |||||
| Natural variant | 38 | 1 | D → E. Ref.1 Ref.2 Ref.4 Ref.8 Corresponds to variant rs3748043 [ dbSNP | Ensembl ]. | VAR_043312 | |||||
| Natural variant | 125 | 1 | A → V. Corresponds to variant rs9687593 [ dbSNP | Ensembl ]. | VAR_056744 | |||||
| Natural variant | 722 | 1 | K → E. Corresponds to variant rs36009281 [ dbSNP | Ensembl ]. | VAR_056745 | |||||
| Natural variant | 757 | 1 | R → C. Ref.3 Ref.4 Ref.8 Corresponds to variant rs3761966 [ dbSNP | Ensembl ]. | VAR_043313 | |||||
| Natural variant | 778 | 1 | V → M. Corresponds to variant rs3761967 [ dbSNP | Ensembl ]. | VAR_043314 | |||||
| Natural variant | 1180 | 1 | G → S. Corresponds to variant rs715748 [ dbSNP | Ensembl ]. | VAR_056746 | |||||
| Natural variant | 1244 | 1 | F → I. Ref.4 Ref.8 Corresponds to variant rs1961760 [ dbSNP | Ensembl ]. | VAR_056747 | |||||
| Natural variant | 1264 | 1 | I → M. Ref.3 Ref.4 Ref.8 Corresponds to variant rs715747 [ dbSNP | Ensembl ]. | VAR_043315 | |||||
| Natural variant | 1347 | 1 | V → M. Ref.1 Ref.2 Ref.3 Ref.4 Ref.8 Corresponds to variant rs6886336 [ dbSNP | Ensembl ]. | VAR_043316 | |||||
| Natural variant | 1469 | 1 | K → E. Ref.4 Ref.8 Corresponds to variant rs1698063 [ dbSNP | Ensembl ]. | VAR_043317 | |||||
| Natural variant | 1676 | 1 | Q → E. Corresponds to variant rs12187098 [ dbSNP | Ensembl ]. | VAR_056748 | |||||
| Natural variant | 2013 | 1 | I → L. Ref.2 Ref.6 Corresponds to variant rs6453014 [ dbSNP | Ensembl ]. | VAR_043318 | |||||
| Natural variant | 2555 | 1 | N → S. Corresponds to variant rs17276250 [ dbSNP | Ensembl ]. | VAR_056749 | |||||
Experimental info | |||||||||
| Mutagenesis | 390 | 1 | S → A: Not phosphorylated by CSNK2A1; when associated with A-426; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-426; A-431; A-437 and A-446. Ref.14 | ||||||
| Mutagenesis | 426 | 1 | S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-431; A-437 and A-446. Ref.14 | ||||||
| Mutagenesis | 431 | 1 | S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-437 and A-446. Ref.14 | ||||||
| Mutagenesis | 437 | 1 | T → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-446. Ref.14 | ||||||
| Mutagenesis | 446 | 1 | S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-437. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-437. Ref.14 | ||||||
| Sequence conflict | 8 | 1 | S → N in AAG09268. Ref.9 | ||||||
| Sequence conflict | 233 | 1 | E → G in AAG30221. Ref.1 | ||||||
| Sequence conflict | 233 | 1 | E → G in AAG30220. Ref.1 | ||||||
| Sequence conflict | 575 | 1 | R → K in BAB71602. Ref.10 | ||||||
| Sequence conflict | 683 | 1 | V → D in CAC21448. Ref.2 | ||||||
| Sequence conflict | 881 | 1 | A → T in AAG09268. Ref.9 | ||||||
| Sequence conflict | 973 | 1 | V → G in CAC21448. Ref.2 | ||||||
| Sequence conflict | 973 | 1 | V → G in CAC04245. Ref.2 | ||||||
| Sequence conflict | 1009 | 1 | E → G in AAG30221. Ref.1 | ||||||
| Sequence conflict | 1009 | 1 | E → G in AAG30220. Ref.1 | ||||||
| Sequence conflict | 2580 | 1 | T → A in CAE46010. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Different human TFIIIB activities direct RNA polymerase III transcription from TATA-containing and TATA-less promoters." Schramm L., Pendergrast P.S., Sun Y., Hernandez N. Genes Dev. 14:2650-2663(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, VARIANTS GLU-38 AND MET-1347. |
| [2] | "The transcription factor-like nuclear regulator (TFNR) contains a novel 55-amino-acid motif repeated nine times and maps closely to SMN1." Kelter A.R., Herchenbach J., Wirth B. Genomics 70:315-326(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-2187 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2189-2624 (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS GLU-38; MET-1347 AND LEU-2013. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANTS CYS-757; MET-1264 AND MET-1347. Tissue: Brain. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469. Tissue: Brain. |
| [5] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1947-2624 (ISOFORM 7), VARIANT LEU-2013. Tissue: Testis. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLU-38; CYS-757; ILE-1244; MET-1264; MET-1347 AND GLU-1469. Tissue: Lung. |
| [9] | "Molecular cloning and functional characterization of human TFIIIB 150." Teichmann M., Wang Z., Ito M., Seifart K.H., Roeder R.G. Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-881 (ISOFORM 1). |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-655 (ISOFORM 6). Tissue: Brain. |
| [11] | "A stable complex of a novel transcription factor IIB- related factor, human TFIIIB50, and associated proteins mediate selective transcription by RNA polymerase III of genes with upstream promoter elements." Teichmann M., Wang Z., Roeder R.G. Proc. Natl. Acad. Sci. U.S.A. 97:14200-14205(2000) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION OF TFIIIB-ALPHA COMPLEX. |
| [12] | "TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo." Fairley J.A., Scott P.H., White R.J. EMBO J. 22:5841-5850(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BRF1. |
| [13] | "Transcription factor (TF)-like nuclear regulator, the 250-kDa form of Homo sapiens TFIIIB', is an essential component of human TFIIIC1 activity." Weser S., Gruber C., Hafner H.M., Teichmann M., Roeder R.G., Seifart K.H., Meissner W. J. Biol. Chem. 279:27022-27029(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION OF TFIIIC1 COMPLEX. |
| [14] | "CK2 phosphorylation of Bdp1 executes cell cycle-specific RNA polymerase III transcription repression." Hu P., Samudre K., Wu S., Sun Y., Hernandez N. Mol. Cell 16:81-92(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, MUTAGENESIS OF SER-390; SER-426; SER-431; THR-437 AND SER-446. |
| [15] | "The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB." Schoenen F., Wirth B. Biol. Chem. 387:277-284(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ZBTB43. |
| [16] | "A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes." Emran F., Florens L., Ma B., Swanson S.K., Washburn M.P., Hernandez N. Gene 377:96-108(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT. |
| [17] | "Epstein-Barr virus induces cellular transcription factors to allow active expression of EBER genes by RNA polymerase III." Felton-Edkins Z.A., Kondrashov A., Karali D., Fairley J.A., Dawson C.W., Arrand J.R., Young L.S., White R.J. J. Biol. Chem. 281:33871-33880(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF298151 mRNA. Translation: AAG30220.1. AF298152 mRNA. Translation: AAG30221.1. AJ238520 mRNA. Translation: CAC04245.1. AJ278892 Genomic DNA. Translation: CAC17771.1. AJ279120 AJ279150 Genomic DNA. Translation: CAC21448.1.AB033067 mRNA. Translation: BAA86555.1. Different initiation. AB051476 mRNA. Translation: BAB21780.3. Different initiation. BX641011 mRNA. Translation: CAE46010.1. CR749229 mRNA. Translation: CAH18085.1. Different initiation. CR749289 mRNA. Translation: CAH18144.1. AC138832 Genomic DNA. No translation available. BC032146 mRNA. Translation: AAH32146.1. Sequence problems. BC146792 mRNA. Translation: AAI46793.1. AF176695 mRNA. Translation: AAG09268.1. Frameshift. AK057871 mRNA. Translation: BAB71602.1. |
| IPI | IPI00470932. IPI00760877. IPI00872938. IPI00893156. IPI00893272. IPI00893280. IPI00893915. IPI00894056. |
| RefSeq | NP_060899.2. NM_018429.2. |
| UniGene | Hs.258272. |
3D structure databases | |
| ProteinModelPortal | A6H8Y1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | A6H8Y1. 2 interactions. |
PTM databases | |
| PhosphoSite | A6H8Y1. |
Proteomic databases | |
| PaxDb | A6H8Y1. |
| PRIDE | A6H8Y1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000358731; ENSP00000351575; ENSG00000145734. ENST00000380675; ENSP00000370050; ENSG00000145734. ENST00000573110; ENSP00000460502; ENSG00000261932. |
| GeneID | 55814. |
| KEGG | hsa:55814. |
| UCSC | uc003kbn.1. human. uc003kbo.3. human. uc003kbp.1. human. |
Organism-specific databases | |
| CTD | 55814. |
| GeneCards | GC05P070787. |
| H-InvDB | HIX0004927. |
| HGNC | HGNC:13652. BDP1. |
| MIM | 607012. gene. |
| neXtProt | NX_A6H8Y1. |
| PharmGKB | PA25336. |
| HUGE | Search... Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5118. |
| HOVERGEN | HBG107497. |
| InParanoid | A6H8Y1. |
| KO | K15198. |
| OMA | KNENESC. |
| PhylomeDB | A6H8Y1. |
Enzyme and pathway databases | |
| Reactome | REACT_1788. Transcription. REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | A6H8Y1. |
| Bgee | A6H8Y1. |
| CleanEx | HS_BDP1. |
| Genevestigator | A6H8Y1. |
Family and domain databases | |
| InterPro | IPR009057. Homeodomain-like. IPR001005. SANT/Myb. [Graphical view] |
| SMART | SM00717. SANT. 1 hit. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. |
| PROSITE | PS50090. MYB_LIKE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BDP1. human. |
| GenomeRNAi | 55814. |
| NextBio | 60990. |
| SOURCE | Search... |
Entry information
| Entry name | BDP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A6H8Y1 Secondary accession number(s): Q68DS6 Q9ULH9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
