Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor TFIIIB component B'' homolog

Gene

BDP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

General activator of RNA polymerase III transcription. Requires for transcription from all three types of polymerase III promoters. Requires for transcription of genes with internal promoter elements and with promoter elements upstream of the initiation site.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
R-HSA-76061. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
R-HSA-76066. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
R-HSA-76071. RNA Polymerase III Transcription Initiation From Type 3 Promoter.
SignaLinkiA6H8Y1.
SIGNORiA6H8Y1.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor TFIIIB component B'' homolog
Alternative name(s):
Transcription factor IIIB 150
Short name:
TFIIIB150
Transcription factor-like nuclear regulator
Gene namesi
Name:BDP1
Synonyms:KIAA1241, KIAA1689, TFNR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:13652. BDP1.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi390S → A: Not phosphorylated by CSNK2A1; when associated with A-426; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-426; A-431; A-437 and A-446. 1 Publication1
Mutagenesisi426S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-431; A-437 and A-446. 1 Publication1
Mutagenesisi431S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-437 and A-446. 1 Publication1
Mutagenesisi437T → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-446. 1 Publication1
Mutagenesisi446S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-437. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-437. 1 Publication1

Organism-specific databases

DisGeNETi55814.
OpenTargetsiENSG00000145734.
ENSG00000273873.
PharmGKBiPA25336.

Polymorphism and mutation databases

BioMutaiBDP1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003338631 – 2624Transcription factor TFIIIB component B'' homologAdd BLAST2624

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei915PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylated by CSNK2A1 during mitosis, resulting in its release from chromatin and suppression of polymerase III transcription.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiA6H8Y1.
MaxQBiA6H8Y1.
PaxDbiA6H8Y1.
PRIDEiA6H8Y1.

PTM databases

iPTMnetiA6H8Y1.
PhosphoSitePlusiA6H8Y1.

Expressioni

Tissue specificityi

Isoform 2 is highly expressed in cerebellum.1 Publication

Inductioni

By Epstein-Barr virus (EBV) resulting in the stimulation of the EBV EBER genes.1 Publication

Gene expression databases

BgeeiENSG00000145734.
CleanExiHS_BDP1.
ExpressionAtlasiA6H8Y1. baseline and differential.
GenevisibleiA6H8Y1. HS.

Organism-specific databases

HPAiHPA043140.
HPA064166.

Interactioni

Subunit structurei

Component of TFIIIB complex. The TFIIIB complex has two activities, alpha and beta. The TFIIIB-alpha and TFIIIB-beta activities are required for transcription of genes with TFIIIC-bound internal promoters and PSE transcription factor-bound external promoters, respectively. The TFIIIB-alpha activity complex is composed of TBP, BDP1, and a complex containing both BRF2 and at least four stably associated proteins; YY1 facilitates the formation of TFIIIB-alpha activity complex. The TFIIIB-beta activity complex is composed of TBP, BDP1, and BRF1. Interacts with BRF1; this interaction diminishes during mitosis resulting in the release of BDP1 from chromosomal templates. Component of TFIIIC complex. The TFIIIC complex has two activities, C1 and C2. The TFIIIC2 activity complex is only required for transcription of the 'classical' pol III genes whereas the TFIIIC1 activity complex is required for transcription of all pol III genes. The TFIIIC1 activity complex is composed at least of BDP1. Interacts with ZBTB43.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120924. 17 interactors.
IntActiA6H8Y1. 17 interactors.
MINTiMINT-5003529.
STRINGi9606.ENSP00000351575.

Structurei

3D structure databases

ProteinModelPortaliA6H8Y1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini295 – 345Myb-likeAdd BLAST51
Repeati823 – 8771; approximateAdd BLAST55
Repeati878 – 9322Add BLAST55
Repeati933 – 9873Add BLAST55
Repeati988 – 10404Add BLAST53
Repeati1041 – 10945Add BLAST54
Repeati1095 – 11486Add BLAST54
Repeati1149 – 12037Add BLAST55
Repeati1204 – 12578; approximateAdd BLAST54
Repeati1258 – 13279; approximateAdd BLAST70

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 299Interaction with ZBTB431 PublicationAdd BLAST299
Regioni355 – 470Required for phosphorylation by CSNK2A1Add BLAST116
Regioni823 – 13279 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-TAdd BLAST505

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili144 – 177Sequence analysisAdd BLAST34
Coiled coili1078 – 1103Sequence analysisAdd BLAST26
Coiled coili1223 – 1284Sequence analysisAdd BLAST62

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi84 – 119Ser-richAdd BLAST36

Sequence similaritiesi

Contains 1 Myb-like domain.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG2009. Eukaryota.
COG5118. LUCA.
GeneTreeiENSGT00390000012762.
HOVERGENiHBG107497.
KOiK15198.
OMAiETETISX.
OrthoDBiEOG091G0GQF.
PhylomeDBiA6H8Y1.
TreeFamiTF328878.

Family and domain databases

InterProiIPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR030701. TFIIIB_B''.
[Graphical view]
PANTHERiPTHR22929. PTHR22929. 3 hits.
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6H8Y1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFRRARLSVK PNVRPGVGAR GSTASNPQRG RESPRPPDPA TDSASKPAEP
60 70 80 90 100
TDVPTVDFGG AEPQEKAPRS STEKTGGDND VEESSRSSST VSQRRKRISS
110 120 130 140 150
TSSLVKSSVS VPSESHPLST INQEAPQPTA TSTKEKQPCS DRYRIYKAQK
160 170 180 190 200
LREMLKEELR KEKKQWKNKY AINESQRPPD RSKMTMRDFI YYLPDNNPMT
210 220 230 240 250
SSLEQEKKTE KPSTPVQTRE QEGKSTPNAE DNEMEEETDD GPLLVPRVKV
260 270 280 290 300
AEDGSIILDE ESLTVEVLRT KGPCVVEEND PIFERGSTTT YSSFRKNYYS
310 320 330 340 350
KPWSNKETDM FFLAISMVGT DFSMIGQLFP HRARIEIKNK FKREEKTNGW
360 370 380 390 400
RIDKAFQEKR PFDFDFFAHL LQKVLAEEEK RKQKSVKNHS LKEKKSTKPR
410 420 430 440 450
KNVKVKKVAC EGVNNDPDES MSSRISDTER SQKDAQTVEE ESLTLSREDA
460 470 480 490 500
EQVALEVDLN QKKRRRKKQD GANELGVNNL LENATVQAGP SKGEKHKNKC
510 520 530 540 550
QAIRPELKEG ECSKEQMLSC TQNIDGIVGF ASTEKVEKRT DPILSLSNQQ
560 570 580 590 600
DATSVATESS ESSTSDLPSF EVGIRALCEV NNAEGSCIEE RNVDLKNNSL
610 620 630 640 650
EIDQTENVKP MLRGRFQRPK PNLSRAGKKS VLSQGKTESE SKNSHSKTSV
660 670 680 690 700
EKNHVEKDKM NTLDILRMET TERENPEAET VSVLGEKNCL QEGSQLKALR
710 720 730 740 750
PVQVRGRLQK PKPNAGKAAE RKEILISQEE IGANVEKNEN ESCADRDTPQ
760 770 780 790 800
HMEDQSRKDF EEEDVILQPE KNDSFQNVQP DEPKVLNECL SVQENNKANK
810 820 830 840 850
LNQVPILRTR FQKPKPNIGR GTGRREISSK EEVLEKILVS GEMAAALRET
860 870 880 890 900
VRLDTSPKEM VPAEINTKEM QSDLKETGRR AISPREKILD VIDDTIEMET
910 920 930 940 950
GLKAMGREIC LREKTPEVID ATEEIDKDLE EAGRREISPQ KNGPEEVKPL
960 970 980 990 1000
GEVETDLKAT GNESSPREKT PEVTDATEEI DKNLEETGRR KISPRENGPE
1010 1020 1030 1040 1050
EVKPVDEMET DLNATGRESS PREKTPEVID ATEEIDLEET EREVSPQENG
1060 1070 1080 1090 1100
LEEVKPLGEM ETDLKATGRD SFPRGKTPEV IDAIEEIEID LEETEREISP
1110 1120 1130 1140 1150
QENGLEEVKP LGEMQTDLKA TGREISPREK TPEVIDATEE IDKDLEETGR
1160 1170 1180 1190 1200
REISPEENGP EEVKPVDEME TDLKTTGREG SSREKTREVI DAAEVIETDL
1210 1220 1230 1240 1250
EETEREISPQ ENGPEEVKPV GKMETDLKEI REEISQREKV LAEFSAIREK
1260 1270 1280 1290 1300
EIDLKETGKR DIPIMEKVSG KMAVVEEMEA DLKETGKENF RERGSEEICV
1310 1320 1330 1340 1350
TEEKVAELKQ TGKTDISPRE NELEETSTSR QTDTHLMQSG SNDFSAVPSL
1360 1370 1380 1390 1400
DIQNISSEVL SMMHTPVEEK RNSEKEVSSH FSHFKISSQT HESDKTEVQG
1410 1420 1430 1440 1450
IQSPDVPEQF SDINLSKSLP QEQKPLEIKP APFVRSRFKR PKPNLARAAL
1460 1470 1480 1490 1500
KRETTESEKY IYEKKSETKK METIVMQENN EQTDTLPSQH DEASLMISRE
1510 1520 1530 1540 1550
KDTLGHRNEE AVILPCTQTE RNLSPSNSCE PKEESQSAPV QKNDSVVSVG
1560 1570 1580 1590 1600
TNNVNTFQQE MKESVIQTAR QVRGRLQRPR PNIRKTGQRQ IVDKGEAKGI
1610 1620 1630 1640 1650
IKEGRTILPK DETEKKVLTV SNSQIETEIE VPSSAVPEHR MYENQSQVVL
1660 1670 1680 1690 1700
VENLHVNKTN ETIRHENKPY VPSSAQMTRR KFQKAKPNLG RAHSKKEEPV
1710 1720 1730 1740 1750
LEKVTTDQSK EGKPEDHLLQ KGASNTQLLL KEKAELLTSL EVSARKDCVG
1760 1770 1780 1790 1800
SKESALAKID AELEEVGPSR RVGEETVGDN SPSSVVEEQY LNKLTSCPQP
1810 1820 1830 1840 1850
LNETSYSKIA LDGKTTISST SEYERNRGER RSHKKFKPNV TRGRGSKRVR
1860 1870 1880 1890 1900
GKTSKKEPRA SKAMLVTLRA SQEEDDDADD FESDYEEESY HLAPEEVNKA
1910 1920 1930 1940 1950
PVFVPVGLRS PEPVSAQIEE TMEELEITVN VPDVGCIAVV EHELPNTDVT
1960 1970 1980 1990 2000
TEEMKQEENL SVPFEMTTSE HIQDEPGTND GSTEAAITLL TMGDLVLQSE
2010 2020 2030 2040 2050
ISSEQGDVGV CIIPHVHSKD KSHIPSSLDN VNHKIVHECQ ELSSPVITTS
2060 2070 2080 2090 2100
PASFEENKIV LEEQSSREEI SLMEKVKENA TPTRNTISKV TSNLRIRSRL
2110 2120 2130 2140 2150
AKPKPNLEKT LGTNRLDDYQ EVSSLCVTKG AEMETQRETE KNASKATELE
2160 2170 2180 2190 2200
NKNLGPVTTA ENKDQSKLAC VHGIKGTSIS SEVNLTERNE NQEESSQEVH
2210 2220 2230 2240 2250
MLSVAPVASS ETGPCTLGLD RGLGENSVEE PQIKDSKGDS VLTLPVPEYT
2260 2270 2280 2290 2300
PTSIPEVQQE NIINPQDLTV NLVANVPQDG EDEQAFILTL VEIPANAVEE
2310 2320 2330 2340 2350
FTDATAQFMP NPLLPAPILV KSVNTEERGD MSICLPATSV GQDAMGLSIS
2360 2370 2380 2390 2400
GRDNSKKPPD NLDLVSRKRF QCRLDKNDHI PPAKKRSLTL RDDCQEYTTE
2410 2420 2430 2440 2450
VHSKELTNVF EETGESHKGQ DIFLTSGSTL TTPEPQRQQV EAAFQSRGSR
2460 2470 2480 2490 2500
SPDACMDKNV PQLPQDEMIV SDKEERTDAA PKSQQMDSRT SSSKASLSRP
2510 2520 2530 2540 2550
GRRPLGFLSL ICSKNSLESD EPMQVHSKKR LKPLIPGLRK KLKRSNPFNE
2560 2570 2580 2590 2600
SQEKNRESSD LLPSPSVITT QSENISSSAT QVSCDQPLLK EGYKSAQKRA
2610 2620
PQGEATTVSE YFFNDIFIEV DETE
Length:2,624
Mass (Da):293,885
Last modified:January 11, 2011 - v3
Checksum:iCB7B80EBBF06B557
GO
Isoform 2 (identifier: A6H8Y1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2249-2254: YTPTSI → VKECTV
     2255-2624: Missing.

Show »
Length:2,254
Mass (Da):252,841
Checksum:i5028C313143A257A
GO
Isoform 3 (identifier: A6H8Y1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTLKNL
     1389-2624: Missing.

Show »
Length:1,388
Mass (Da):156,401
Checksum:iCA5A8B8025222C59
GO
Isoform 4 (identifier: A6H8Y1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1372: NISSEVLSMMHTPVEEKRN → VCIFLSFKSFLNAFFRGNK
     1373-2624: Missing.

Show »
Length:1,372
Mass (Da):154,704
Checksum:iE9E1E54C426362F8
GO
Isoform 5 (identifier: A6H8Y1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-610: Missing.
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTFKNL
     1389-2624: Missing.

Note: No experimental confirmation available.
Show »
Length:778
Mass (Da):87,789
Checksum:iB0472F9FC6FB6897
GO
Isoform 6 (identifier: A6H8Y1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-43: Missing.

Note: No experimental confirmation available.
Show »
Length:2,604
Mass (Da):291,768
Checksum:i006AAB63089EB64F
GO
Isoform 7 (identifier: A6H8Y1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1977-2008: Missing.
     2582-2584: VSC → RPF
     2585-2624: Missing.

Note: No experimental confirmation available.
Show »
Length:2,552
Mass (Da):286,185
Checksum:iF159FF75502B6844
GO
Isoform 8 (identifier: A6H8Y1-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1863: Missing.
     2008-2008: Missing.
     2271-2327: NLVANVPQDG...ILVKSVNTEE → FVYQQLQLVK...FLLPKNVHSL
     2328-2624: Missing.

Note: No experimental confirmation available.
Show »
Length:463
Mass (Da):51,420
Checksum:i054AFA93526C7083
GO

Sequence cautioni

The sequence AAG09268 differs from that shown. Reason: Frameshift at positions 837 and 863.Curated
The sequence AAH32146 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA86555 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB21780 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAH18085 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8S → N in AAG09268 (Ref. 9) Curated1
Sequence conflicti233E → G in AAG30221 (PubMed:11040218).Curated1
Sequence conflicti233E → G in AAG30220 (PubMed:11040218).Curated1
Sequence conflicti575R → K in BAB71602 (PubMed:14702039).Curated1
Sequence conflicti683V → D in CAC21448 (PubMed:11161782).Curated1
Sequence conflicti881A → T in AAG09268 (Ref. 9) Curated1
Sequence conflicti973V → G in CAC21448 (PubMed:11161782).Curated1
Sequence conflicti973V → G in CAC04245 (PubMed:11161782).Curated1
Sequence conflicti1009E → G in AAG30221 (PubMed:11040218).Curated1
Sequence conflicti1009E → G in AAG30220 (PubMed:11040218).Curated1
Sequence conflicti2580T → A in CAE46010 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05674326N → S.Corresponds to variant rs3748042dbSNPEnsembl.1
Natural variantiVAR_04331238D → E.4 PublicationsCorresponds to variant rs3748043dbSNPEnsembl.1
Natural variantiVAR_056744125A → V.Corresponds to variant rs9687593dbSNPEnsembl.1
Natural variantiVAR_056745722K → E.Corresponds to variant rs36009281dbSNPEnsembl.1
Natural variantiVAR_043313757R → C.3 PublicationsCorresponds to variant rs3761966dbSNPEnsembl.1
Natural variantiVAR_043314778V → M.Corresponds to variant rs3761967dbSNPEnsembl.1
Natural variantiVAR_0567461180G → S.Corresponds to variant rs715748dbSNPEnsembl.1
Natural variantiVAR_0567471244F → I.2 PublicationsCorresponds to variant rs1961760dbSNPEnsembl.1
Natural variantiVAR_0433151264I → M.3 PublicationsCorresponds to variant rs715747dbSNPEnsembl.1
Natural variantiVAR_0433161347V → M.5 PublicationsCorresponds to variant rs6886336dbSNPEnsembl.1
Natural variantiVAR_0433171469K → E.2 PublicationsCorresponds to variant rs1698063dbSNPEnsembl.1
Natural variantiVAR_0567481676Q → E.Corresponds to variant rs12187098dbSNPEnsembl.1
Natural variantiVAR_0433182013I → L.2 PublicationsCorresponds to variant rs6453014dbSNPEnsembl.1
Natural variantiVAR_0567492555N → S.Corresponds to variant rs17276250dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0335671 – 1863Missing in isoform 8. 1 PublicationAdd BLAST1863
Alternative sequenceiVSP_0335681 – 610Missing in isoform 5. 1 PublicationAdd BLAST610
Alternative sequenceiVSP_03356924 – 43Missing in isoform 6. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0335701354 – 1388NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTLKNL in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0335711354 – 1388NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTFKNL in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0335721354 – 1372NISSE…EEKRN → VCIFLSFKSFLNAFFRGNK in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0335731373 – 2624Missing in isoform 4. 1 PublicationAdd BLAST1252
Alternative sequenceiVSP_0335741389 – 2624Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST1236
Alternative sequenceiVSP_0335751977 – 2008Missing in isoform 7. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0335762008Missing in isoform 8. 1 Publication1
Alternative sequenceiVSP_0335772249 – 2254YTPTSI → VKECTV in isoform 2. 1 Publication6
Alternative sequenceiVSP_0335782255 – 2624Missing in isoform 2. 1 PublicationAdd BLAST370
Alternative sequenceiVSP_0335792271 – 2327NLVAN…VNTEE → FVYQQLQLVKMPWVYLFLEE IILKSRLIIWILYLGRDFNA GLIKMTTFLLPKNVHSL in isoform 8. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0335802328 – 2624Missing in isoform 8. 1 PublicationAdd BLAST297
Alternative sequenceiVSP_0335812582 – 2584VSC → RPF in isoform 7. 1 Publication3
Alternative sequenceiVSP_0335822585 – 2624Missing in isoform 7. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF298151 mRNA. Translation: AAG30220.1.
AF298152 mRNA. Translation: AAG30221.1.
AJ238520 mRNA. Translation: CAC04245.1.
AJ278892 Genomic DNA. Translation: CAC17771.1.
AJ279120
, AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA. Translation: CAC21448.1.
AB033067 mRNA. Translation: BAA86555.1. Different initiation.
AB051476 mRNA. Translation: BAB21780.3. Different initiation.
BX641011 mRNA. Translation: CAE46010.1.
CR749229 mRNA. Translation: CAH18085.1. Different initiation.
CR749289 mRNA. Translation: CAH18144.1.
AC138832 Genomic DNA. No translation available.
BC032146 mRNA. Translation: AAH32146.1. Sequence problems.
BC146792 mRNA. Translation: AAI46793.1.
AF176695 mRNA. Translation: AAG09268.1. Frameshift.
AK057871 mRNA. Translation: BAB71602.1.
CCDSiCCDS43328.1. [A6H8Y1-1]
RefSeqiNP_060899.2. NM_018429.2. [A6H8Y1-1]
UniGeneiHs.258272.

Genome annotation databases

EnsembliENST00000358731; ENSP00000351575; ENSG00000145734. [A6H8Y1-1]
ENST00000617085; ENSP00000482469; ENSG00000273873. [A6H8Y1-1]
GeneIDi55814.
KEGGihsa:55814.
UCSCiuc003kbp.2. human. [A6H8Y1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF298151 mRNA. Translation: AAG30220.1.
AF298152 mRNA. Translation: AAG30221.1.
AJ238520 mRNA. Translation: CAC04245.1.
AJ278892 Genomic DNA. Translation: CAC17771.1.
AJ279120
, AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA. Translation: CAC21448.1.
AB033067 mRNA. Translation: BAA86555.1. Different initiation.
AB051476 mRNA. Translation: BAB21780.3. Different initiation.
BX641011 mRNA. Translation: CAE46010.1.
CR749229 mRNA. Translation: CAH18085.1. Different initiation.
CR749289 mRNA. Translation: CAH18144.1.
AC138832 Genomic DNA. No translation available.
BC032146 mRNA. Translation: AAH32146.1. Sequence problems.
BC146792 mRNA. Translation: AAI46793.1.
AF176695 mRNA. Translation: AAG09268.1. Frameshift.
AK057871 mRNA. Translation: BAB71602.1.
CCDSiCCDS43328.1. [A6H8Y1-1]
RefSeqiNP_060899.2. NM_018429.2. [A6H8Y1-1]
UniGeneiHs.258272.

3D structure databases

ProteinModelPortaliA6H8Y1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120924. 17 interactors.
IntActiA6H8Y1. 17 interactors.
MINTiMINT-5003529.
STRINGi9606.ENSP00000351575.

PTM databases

iPTMnetiA6H8Y1.
PhosphoSitePlusiA6H8Y1.

Polymorphism and mutation databases

BioMutaiBDP1.

Proteomic databases

EPDiA6H8Y1.
MaxQBiA6H8Y1.
PaxDbiA6H8Y1.
PRIDEiA6H8Y1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358731; ENSP00000351575; ENSG00000145734. [A6H8Y1-1]
ENST00000617085; ENSP00000482469; ENSG00000273873. [A6H8Y1-1]
GeneIDi55814.
KEGGihsa:55814.
UCSCiuc003kbp.2. human. [A6H8Y1-1]

Organism-specific databases

CTDi55814.
DisGeNETi55814.
GeneCardsiBDP1.
H-InvDBHIX0004927.
HGNCiHGNC:13652. BDP1.
HPAiHPA043140.
HPA064166.
MIMi607012. gene.
neXtProtiNX_A6H8Y1.
OpenTargetsiENSG00000145734.
ENSG00000273873.
PharmGKBiPA25336.
HUGEiSearch...
Search...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2009. Eukaryota.
COG5118. LUCA.
GeneTreeiENSGT00390000012762.
HOVERGENiHBG107497.
KOiK15198.
OMAiETETISX.
OrthoDBiEOG091G0GQF.
PhylomeDBiA6H8Y1.
TreeFamiTF328878.

Enzyme and pathway databases

ReactomeiR-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
R-HSA-76061. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
R-HSA-76066. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
R-HSA-76071. RNA Polymerase III Transcription Initiation From Type 3 Promoter.
SignaLinkiA6H8Y1.
SIGNORiA6H8Y1.

Miscellaneous databases

ChiTaRSiBDP1. human.
GeneWikiiBDP1.
GenomeRNAii55814.
PROiA6H8Y1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000145734.
CleanExiHS_BDP1.
ExpressionAtlasiA6H8Y1. baseline and differential.
GenevisibleiA6H8Y1. HS.

Family and domain databases

InterProiIPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR030701. TFIIIB_B''.
[Graphical view]
PANTHERiPTHR22929. PTHR22929. 3 hits.
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiBDP1_HUMAN
AccessioniPrimary (citable) accession number: A6H8Y1
Secondary accession number(s): Q68DS6
, Q68DY5, Q6MZL9, Q6PIM7, Q86W98, Q96LR8, Q9C0H4, Q9H197, Q9H1A1, Q9HAW1, Q9HAW2, Q9HCY0, Q9ULH9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: January 11, 2011
Last modified: November 30, 2016
This is version 88 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.