SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A6H8M9

- CDHR4_HUMAN

UniProt

A6H8M9 - CDHR4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cadherin-related family member 4
Gene
CDHR4, CDH29, UNQ9392/PRO34300
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types By similarity.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. homophilic cell adhesion Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-related family member 4
Alternative name(s):
Cadherin-like protein 29
Gene namesi
Name:CDHR4
Synonyms:CDH29
ORF Names:UNQ9392/PRO34300
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:34527. CDHR4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 686670Extracellular Reviewed prediction
Add
BLAST
Transmembranei687 – 70721Helical; Reviewed prediction
Add
BLAST
Topological domaini708 – 78881Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165696944.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616 Reviewed prediction
Add
BLAST
Chaini17 – 788772Cadherin-related family member 4
PRO_0000319973Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi242 – 2421N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA6H8M9.
PRIDEiA6H8M9.

PTM databases

PhosphoSiteiA6H8M9.

Expressioni

Gene expression databases

BgeeiA6H8M9.
CleanExiHS_CDH29.
GenevestigatoriA6H8M9.

Organism-specific databases

HPAiHPA043330.

Structurei

3D structure databases

ProteinModelPortaliA6H8M9.
SMRiA6H8M9. Positions 448-622.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini237 – 338102Cadherin 1
Add
BLAST
Domaini339 – 449111Cadherin 2
Add
BLAST
Domaini444 – 554111Cadherin 3
Add
BLAST
Domaini551 – 674124Cadherin 4
Add
BLAST

Sequence similaritiesi

Contains 4 cadherin domains.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG74757.
HOGENOMiHOG000111287.
KOiK16504.
OMAiPPFQELT.
OrthoDBiEOG744TBP.
PhylomeDBiA6H8M9.
TreeFamiTF341878.

Family and domain databases

Gene3Di2.60.40.60. 3 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 2 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 4 hits.
PROSITEiPS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A6H8M9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVLLRLLVFL FAPVVSDLCS LPCFINVSES QGPGTVLQFL SFNCSSYTPT    50
PTLELLNVQP PTTFFNPPSL ARWQGTYVGK LTLSSSAQLD ALMVNHYKVQ 100
LKFTCGNHVM EGSLSVDVQR DLSHIQCAGQ FASPAGEMIQ VPETVTPGAR 150
LYTLLLPGLE LHGAQMSIIS AQDLPHFPGP FSINEQGWLQ APSQGLLGQA 200
QKVFQLQISV SFGQRQSCQG MVIVKVLPVP SSQVSFLEQA QNITIPENLA 250
PGSEVVQVQA RGVDLRYEIL SPVPSPLFSI GRADGVVRTT TPLELARTSG 300
TAVSRLQVKA FEQGQLWASA KLNLTMNVQL VNLWPPRCLP ALLVSQIPET 350
APVGTVLNTL TCEDPDSVGA TLDYKLWFRS SSNPASLCLY DRVLEVNATL 400
DCDTPGACFQ HAASILVLDG GQPQMTTEVP VLVMVTPINE FSPACAPRTF 450
RVQEDAAPHT LLGSVVGTDM DYPHDNIEYY TSGGPTTFAV DRLSGEVHLL 500
GPLDYEQQRL YRLTVLVIDH GQDQNPNHHL SGSCTITIEV EDVNDHAPEC 550
EPPFQELTIY APLGRSVEVT KMSCQIPQEP QRLIYSYSIV GGNSQNRFIL 600
QGAILVHSDL VLGPFWPEQP RTYELLICVA DAGPSTPHLS TTATIIVHLV 650
PRRASTVATS THRTTVPSTM TPMLVTDTEA FWQPQPWFVV VLTATGALLL 700
LALGWLLGRL LQGLAQLLQA PSKPAQALLL NSIQGTEGSI EGFLEAPKME 750
MSQAPSSVMS LHFDGRAQDS RTGRDYLFNT HTGARRWL 788
Length:788
Mass (Da):85,827
Last modified:July 24, 2007 - v1
Checksum:iAAC5C9F6908DBF67
GO
Isoform 2 (identifier: A6H8M9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
     136-788: Missing.

Show »
Length:199
Mass (Da):21,388
Checksum:iD42B51E25AEC77AF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti5 – 51R → K.
Corresponds to variant rs13072748 [ dbSNP | Ensembl ].
VAR_039109

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei135 – 1351A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2.
VSP_031552
Alternative sequencei136 – 788653Missing in isoform 2.
VSP_031553Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358221 mRNA. Translation: AAQ88588.1.
BC132756 mRNA. Translation: AAI32757.1.
BC146674 mRNA. Translation: AAI46675.1.
CCDSiCCDS46829.1. [A6H8M9-1]
RefSeqiNP_001007541.2. NM_001007540.2. [A6H8M9-1]
UniGeneiHs.363312.

Genome annotation databases

EnsembliENST00000343366; ENSP00000341302; ENSG00000187492. [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492. [A6H8M9-1]
GeneIDi389118.
KEGGihsa:389118.
UCSCiuc003cxp.2. human. [A6H8M9-2]
uc010hkz.3. human. [A6H8M9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358221 mRNA. Translation: AAQ88588.1 .
BC132756 mRNA. Translation: AAI32757.1 .
BC146674 mRNA. Translation: AAI46675.1 .
CCDSi CCDS46829.1. [A6H8M9-1 ]
RefSeqi NP_001007541.2. NM_001007540.2. [A6H8M9-1 ]
UniGenei Hs.363312.

3D structure databases

ProteinModelPortali A6H8M9.
SMRi A6H8M9. Positions 448-622.
ModBasei Search...

PTM databases

PhosphoSitei A6H8M9.

Proteomic databases

PaxDbi A6H8M9.
PRIDEi A6H8M9.

Protocols and materials databases

DNASUi 389118.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343366 ; ENSP00000341302 ; ENSG00000187492 . [A6H8M9-2 ]
ENST00000412678 ; ENSP00000391409 ; ENSG00000187492 . [A6H8M9-1 ]
GeneIDi 389118.
KEGGi hsa:389118.
UCSCi uc003cxp.2. human. [A6H8M9-2 ]
uc010hkz.3. human. [A6H8M9-1 ]

Organism-specific databases

CTDi 389118.
GeneCardsi GC03M049828.
HGNCi HGNC:34527. CDHR4.
HPAi HPA043330.
neXtProti NX_A6H8M9.
PharmGKBi PA165696944.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG74757.
HOGENOMi HOG000111287.
KOi K16504.
OMAi PPFQELT.
OrthoDBi EOG744TBP.
PhylomeDBi A6H8M9.
TreeFami TF341878.

Miscellaneous databases

GenomeRNAii 389118.
NextBioi 102601.
PROi A6H8M9.

Gene expression databases

Bgeei A6H8M9.
CleanExi HS_CDH29.
Genevestigatori A6H8M9.

Family and domain databases

Gene3Di 2.60.40.60. 3 hits.
InterProi IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view ]
Pfami PF00028. Cadherin. 1 hit.
[Graphical view ]
PRINTSi PR00205. CADHERIN.
SMARTi SM00112. CA. 2 hits.
[Graphical view ]
SUPFAMi SSF49313. SSF49313. 4 hits.
PROSITEi PS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

Entry informationi

Entry nameiCDHR4_HUMAN
AccessioniPrimary (citable) accession number: A6H8M9
Secondary accession number(s): Q6UXT0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 24, 2007
Last modified: July 9, 2014
This is version 64 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi