Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-related family member 4

Gene

CDHR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BioCyciZFISH:G66-33854-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-related family member 4
Alternative name(s):
Cadherin-like protein 29
Gene namesi
Name:CDHR4
Synonyms:CDH29
ORF Names:UNQ9392/PRO34300
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:34527. CDHR4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini17 – 686ExtracellularSequence analysisAdd BLAST670
Transmembranei687 – 707HelicalSequence analysisAdd BLAST21
Topological domaini708 – 788CytoplasmicSequence analysisAdd BLAST81

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000187492.
PharmGKBiPA165696944.

Polymorphism and mutation databases

BioMutaiCDHR4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000031997317 – 788Cadherin-related family member 4Add BLAST772

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi242N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA6H8M9.
PRIDEiA6H8M9.

PTM databases

iPTMnetiA6H8M9.
PhosphoSitePlusiA6H8M9.

Expressioni

Gene expression databases

BgeeiENSG00000187492.
CleanExiHS_CDH29.
ExpressionAtlasiA6H8M9. baseline and differential.

Organism-specific databases

HPAiHPA043330.

Structurei

3D structure databases

ProteinModelPortaliA6H8M9.
SMRiA6H8M9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini237 – 338Cadherin 1PROSITE-ProRule annotationAdd BLAST102
Domaini339 – 449Cadherin 2PROSITE-ProRule annotationAdd BLAST111
Domaini444 – 554Cadherin 3PROSITE-ProRule annotationAdd BLAST111
Domaini551 – 674Cadherin 4PROSITE-ProRule annotationAdd BLAST124

Sequence similaritiesi

Contains 4 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410ISUN. Eukaryota.
ENOG4110NJ5. LUCA.
GeneTreeiENSGT00650000093370.
HOGENOMiHOG000111287.
InParanoidiA6H8M9.
KOiK16504.
OMAiCFQHAAS.
OrthoDBiEOG091G05GI.
PhylomeDBiA6H8M9.
TreeFamiTF341878.

Family and domain databases

Gene3Di2.60.40.60. 4 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 2 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 4 hits.
PROSITEiPS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A6H8M9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLLRLLVFL FAPVVSDLCS LPCFINVSES QGPGTVLQFL SFNCSSYTPT
60 70 80 90 100
PTLELLNVQP PTTFFNPPSL ARWQGTYVGK LTLSSSAQLD ALMVNHYKVQ
110 120 130 140 150
LKFTCGNHVM EGSLSVDVQR DLSHIQCAGQ FASPAGEMIQ VPETVTPGAR
160 170 180 190 200
LYTLLLPGLE LHGAQMSIIS AQDLPHFPGP FSINEQGWLQ APSQGLLGQA
210 220 230 240 250
QKVFQLQISV SFGQRQSCQG MVIVKVLPVP SSQVSFLEQA QNITIPENLA
260 270 280 290 300
PGSEVVQVQA RGVDLRYEIL SPVPSPLFSI GRADGVVRTT TPLELARTSG
310 320 330 340 350
TAVSRLQVKA FEQGQLWASA KLNLTMNVQL VNLWPPRCLP ALLVSQIPET
360 370 380 390 400
APVGTVLNTL TCEDPDSVGA TLDYKLWFRS SSNPASLCLY DRVLEVNATL
410 420 430 440 450
DCDTPGACFQ HAASILVLDG GQPQMTTEVP VLVMVTPINE FSPACAPRTF
460 470 480 490 500
RVQEDAAPHT LLGSVVGTDM DYPHDNIEYY TSGGPTTFAV DRLSGEVHLL
510 520 530 540 550
GPLDYEQQRL YRLTVLVIDH GQDQNPNHHL SGSCTITIEV EDVNDHAPEC
560 570 580 590 600
EPPFQELTIY APLGRSVEVT KMSCQIPQEP QRLIYSYSIV GGNSQNRFIL
610 620 630 640 650
QGAILVHSDL VLGPFWPEQP RTYELLICVA DAGPSTPHLS TTATIIVHLV
660 670 680 690 700
PRRASTVATS THRTTVPSTM TPMLVTDTEA FWQPQPWFVV VLTATGALLL
710 720 730 740 750
LALGWLLGRL LQGLAQLLQA PSKPAQALLL NSIQGTEGSI EGFLEAPKME
760 770 780
MSQAPSSVMS LHFDGRAQDS RTGRDYLFNT HTGARRWL
Length:788
Mass (Da):85,827
Last modified:July 24, 2007 - v1
Checksum:iAAC5C9F6908DBF67
GO
Isoform 2 (identifier: A6H8M9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
     136-788: Missing.

Show »
Length:199
Mass (Da):21,388
Checksum:iD42B51E25AEC77AF
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0391095R → K.Corresponds to variant rs13072748dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031552135A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2. 2 Publications1
Alternative sequenceiVSP_031553136 – 788Missing in isoform 2. 2 PublicationsAdd BLAST653

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358221 mRNA. Translation: AAQ88588.1.
BC132756 mRNA. Translation: AAI32757.1.
BC146674 mRNA. Translation: AAI46675.1.
CCDSiCCDS46829.1. [A6H8M9-1]
RefSeqiNP_001007541.2. NM_001007540.3. [A6H8M9-1]
UniGeneiHs.363312.

Genome annotation databases

EnsembliENST00000343366; ENSP00000341302; ENSG00000187492. [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492. [A6H8M9-1]
GeneIDi389118.
KEGGihsa:389118.
UCSCiuc003cxp.3. human. [A6H8M9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358221 mRNA. Translation: AAQ88588.1.
BC132756 mRNA. Translation: AAI32757.1.
BC146674 mRNA. Translation: AAI46675.1.
CCDSiCCDS46829.1. [A6H8M9-1]
RefSeqiNP_001007541.2. NM_001007540.3. [A6H8M9-1]
UniGeneiHs.363312.

3D structure databases

ProteinModelPortaliA6H8M9.
SMRiA6H8M9.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiA6H8M9.
PhosphoSitePlusiA6H8M9.

Polymorphism and mutation databases

BioMutaiCDHR4.

Proteomic databases

PaxDbiA6H8M9.
PRIDEiA6H8M9.

Protocols and materials databases

DNASUi389118.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343366; ENSP00000341302; ENSG00000187492. [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492. [A6H8M9-1]
GeneIDi389118.
KEGGihsa:389118.
UCSCiuc003cxp.3. human. [A6H8M9-1]

Organism-specific databases

CTDi389118.
GeneCardsiCDHR4.
HGNCiHGNC:34527. CDHR4.
HPAiHPA043330.
neXtProtiNX_A6H8M9.
OpenTargetsiENSG00000187492.
PharmGKBiPA165696944.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ISUN. Eukaryota.
ENOG4110NJ5. LUCA.
GeneTreeiENSGT00650000093370.
HOGENOMiHOG000111287.
InParanoidiA6H8M9.
KOiK16504.
OMAiCFQHAAS.
OrthoDBiEOG091G05GI.
PhylomeDBiA6H8M9.
TreeFamiTF341878.

Enzyme and pathway databases

BioCyciZFISH:G66-33854-MONOMER.

Miscellaneous databases

GenomeRNAii389118.
PROiA6H8M9.

Gene expression databases

BgeeiENSG00000187492.
CleanExiHS_CDH29.
ExpressionAtlasiA6H8M9. baseline and differential.

Family and domain databases

Gene3Di2.60.40.60. 4 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 2 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 4 hits.
PROSITEiPS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCDHR4_HUMAN
AccessioniPrimary (citable) accession number: A6H8M9
Secondary accession number(s): Q6UXT0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 24, 2007
Last modified: November 30, 2016
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.