A6H8M9 (CDHR4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 54.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cadherin-related family member 4 Alternative name(s): Cadherin-like protein 29 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 788 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. |
| Sequence similarities | Contains 4 cadherin domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Ligand | Calcium |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | homophilic cell adhesion Inferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: InterPro |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A6H8M9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A6H8M9-2) The sequence of this isoform differs from the canonical sequence as follows: 135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG 136-788: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||
| Chain | 17 – 788 | 772 | Cadherin-related family member 4 | PRO_0000319973 | |||||
Regions | |||||||||
| Topological domain | 17 – 686 | 670 | Extracellular Potential | ||||||
| Transmembrane | 687 – 707 | 21 | Helical; Potential | ||||||
| Topological domain | 708 – 788 | 81 | Cytoplasmic Potential | ||||||
| Domain | 237 – 338 | 102 | Cadherin 1 | ||||||
| Domain | 339 – 449 | 111 | Cadherin 2 | ||||||
| Domain | 444 – 554 | 111 | Cadherin 3 | ||||||
| Domain | 551 – 674 | 124 | Cadherin 4 | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 242 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 135 | 1 | A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2. | VSP_031552 | |||||
| Alternative sequence | 136 – 788 | 653 | Missing in isoform 2. | VSP_031553 | |||||
| Natural variant | 5 | 1 | R → K. Corresponds to variant rs13072748 [ dbSNP | Ensembl ]. | VAR_039109 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358221 mRNA. Translation: AAQ88588.1. BC132756 mRNA. Translation: AAI32757.1. BC146674 mRNA. Translation: AAI46675.1. |
| IPI | IPI00397966. IPI00397967. |
| RefSeq | NP_001007541.2. NM_001007540.2. |
| UniGene | Hs.363312. |
3D structure databases | |
| ProteinModelPortal | A6H8M9. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | A6H8M9. |
Proteomic databases | |
| PaxDb | A6H8M9. |
| PRIDE | A6H8M9. |
Protocols and materials databases | |
| DNASU | 389118. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000343366; ENSP00000341302; ENSG00000187492. ENST00000412678; ENSP00000391409; ENSG00000187492. |
| GeneID | 389118. |
| KEGG | hsa:389118. |
| UCSC | uc003cxp.2. human. uc010hkz.3. human. |
Organism-specific databases | |
| CTD | 389118. |
| GeneCards | GC03M049828. |
| HGNC | HGNC:34527. CDHR4. |
| HPA | HPA043330. |
| neXtProt | NX_A6H8M9. |
| PharmGKB | PA165696944. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG74757. |
| HOGENOM | HOG000111287. |
| KO | K16504. |
| OMA | PPFQELT. |
| OrthoDB | EOG4MCX1C. |
Gene expression databases | |
| ArrayExpress | A6H8M9. |
| Bgee | A6H8M9. |
| CleanEx | HS_CDH29. |
| Genevestigator | A6H8M9. |
Family and domain databases | |
| Gene3D | 2.60.40.60. 3 hits. |
| InterPro | IPR002126. Cadherin. IPR015919. Cadherin-like. IPR020894. Cadherin_CS. [Graphical view] |
| Pfam | PF00028. Cadherin. 1 hit. [Graphical view] |
| PRINTS | PR00205. CADHERIN. |
| SMART | SM00112. CA. 2 hits. [Graphical view] |
| SUPFAM | SSF49313. Cadherin. 4 hits. |
| PROSITE | PS00232. CADHERIN_1. 1 hit. PS50268. CADHERIN_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 389118. |
| NextBio | 102601. |
Entry information
| Entry name | CDHR4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A6H8M9 Secondary accession number(s): Q6UXT0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
