Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A6H8M9 (CDHR4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 61. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cadherin-related family member 4
Alternative name(s):
Cadherin-like protein 29
Gene names
Name:CDHR4
Synonyms:CDH29
ORF Names:UNQ9392/PRO34300
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length788 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Sequence similarities

Contains 4 cadherin domains.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   LigandCalcium
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processhomophilic cell adhesion

Inferred from electronic annotation. Source: InterPro

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: InterPro

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A6H8M9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A6H8M9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
     136-788: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1616 Potential
Chain17 – 788772Cadherin-related family member 4
PRO_0000319973

Regions

Topological domain17 – 686670Extracellular Potential
Transmembrane687 – 70721Helical; Potential
Topological domain708 – 78881Cytoplasmic Potential
Domain237 – 338102Cadherin 1
Domain339 – 449111Cadherin 2
Domain444 – 554111Cadherin 3
Domain551 – 674124Cadherin 4

Amino acid modifications

Glycosylation2421N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1351A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2.
VSP_031552
Alternative sequence136 – 788653Missing in isoform 2.
VSP_031553
Natural variant51R → K.
Corresponds to variant rs13072748 [ dbSNP | Ensembl ].
VAR_039109

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 24, 2007. Version 1.
Checksum: AAC5C9F6908DBF67

FASTA78885,827
        10         20         30         40         50         60 
MVLLRLLVFL FAPVVSDLCS LPCFINVSES QGPGTVLQFL SFNCSSYTPT PTLELLNVQP 

        70         80         90        100        110        120 
PTTFFNPPSL ARWQGTYVGK LTLSSSAQLD ALMVNHYKVQ LKFTCGNHVM EGSLSVDVQR 

       130        140        150        160        170        180 
DLSHIQCAGQ FASPAGEMIQ VPETVTPGAR LYTLLLPGLE LHGAQMSIIS AQDLPHFPGP 

       190        200        210        220        230        240 
FSINEQGWLQ APSQGLLGQA QKVFQLQISV SFGQRQSCQG MVIVKVLPVP SSQVSFLEQA 

       250        260        270        280        290        300 
QNITIPENLA PGSEVVQVQA RGVDLRYEIL SPVPSPLFSI GRADGVVRTT TPLELARTSG 

       310        320        330        340        350        360 
TAVSRLQVKA FEQGQLWASA KLNLTMNVQL VNLWPPRCLP ALLVSQIPET APVGTVLNTL 

       370        380        390        400        410        420 
TCEDPDSVGA TLDYKLWFRS SSNPASLCLY DRVLEVNATL DCDTPGACFQ HAASILVLDG 

       430        440        450        460        470        480 
GQPQMTTEVP VLVMVTPINE FSPACAPRTF RVQEDAAPHT LLGSVVGTDM DYPHDNIEYY 

       490        500        510        520        530        540 
TSGGPTTFAV DRLSGEVHLL GPLDYEQQRL YRLTVLVIDH GQDQNPNHHL SGSCTITIEV 

       550        560        570        580        590        600 
EDVNDHAPEC EPPFQELTIY APLGRSVEVT KMSCQIPQEP QRLIYSYSIV GGNSQNRFIL 

       610        620        630        640        650        660 
QGAILVHSDL VLGPFWPEQP RTYELLICVA DAGPSTPHLS TTATIIVHLV PRRASTVATS 

       670        680        690        700        710        720 
THRTTVPSTM TPMLVTDTEA FWQPQPWFVV VLTATGALLL LALGWLLGRL LQGLAQLLQA 

       730        740        750        760        770        780 
PSKPAQALLL NSIQGTEGSI EGFLEAPKME MSQAPSSVMS LHFDGRAQDS RTGRDYLFNT 


HTGARRWL 

« Hide

Isoform 2 [UniParc].

Checksum: D42B51E25AEC77AF
Show »

FASTA19921,388

References

[1]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY358221 mRNA. Translation: AAQ88588.1.
BC132756 mRNA. Translation: AAI32757.1.
BC146674 mRNA. Translation: AAI46675.1.
RefSeqNP_001007541.2. NM_001007540.2.
UniGeneHs.363312.

3D structure databases

ProteinModelPortalA6H8M9.
SMRA6H8M9. Positions 139-654.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteA6H8M9.

Proteomic databases

PaxDbA6H8M9.
PRIDEA6H8M9.

Protocols and materials databases

DNASU389118.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000343366; ENSP00000341302; ENSG00000187492. [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492. [A6H8M9-1]
GeneID389118.
KEGGhsa:389118.
UCSCuc003cxp.2. human. [A6H8M9-2]
uc010hkz.3. human. [A6H8M9-1]

Organism-specific databases

CTD389118.
GeneCardsGC03M049828.
HGNCHGNC:34527. CDHR4.
HPAHPA043330.
neXtProtNX_A6H8M9.
PharmGKBPA165696944.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG74757.
HOGENOMHOG000111287.
KOK16504.
OMAPPFQELT.
OrthoDBEOG744TBP.
PhylomeDBA6H8M9.
TreeFamTF341878.

Gene expression databases

BgeeA6H8M9.
CleanExHS_CDH29.
GenevestigatorA6H8M9.

Family and domain databases

Gene3D2.60.40.60. 3 hits.
InterProIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamPF00028. Cadherin. 1 hit.
[Graphical view]
PRINTSPR00205. CADHERIN.
SMARTSM00112. CA. 2 hits.
[Graphical view]
SUPFAMSSF49313. SSF49313. 4 hits.
PROSITEPS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi389118.
NextBio102601.
PROA6H8M9.

Entry information

Entry nameCDHR4_HUMAN
AccessionPrimary (citable) accession number: A6H8M9
Secondary accession number(s): Q6UXT0
Entry history
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 24, 2007
Last modified: April 16, 2014
This is version 61 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM