Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A6H8M9

- CDHR4_HUMAN

UniProt

A6H8M9 - CDHR4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cadherin-related family member 4

Gene

CDHR4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (By similarity).By similarity

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. homophilic cell adhesion via plasma membrane adhesion molecules Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-related family member 4
Alternative name(s):
Cadherin-like protein 29
Gene namesi
Name:CDHR4
Synonyms:CDH29
ORF Names:UNQ9392/PRO34300
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:34527. CDHR4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 686670ExtracellularSequence AnalysisAdd
BLAST
Transmembranei687 – 70721HelicalSequence AnalysisAdd
BLAST
Topological domaini708 – 78881CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165696944.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Chaini17 – 788772Cadherin-related family member 4PRO_0000319973Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi242 – 2421N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiA6H8M9.
PRIDEiA6H8M9.

PTM databases

PhosphoSiteiA6H8M9.

Expressioni

Gene expression databases

BgeeiA6H8M9.
CleanExiHS_CDH29.
ExpressionAtlasiA6H8M9. baseline.
GenevestigatoriA6H8M9.

Organism-specific databases

HPAiHPA043330.

Structurei

3D structure databases

ProteinModelPortaliA6H8M9.
SMRiA6H8M9. Positions 448-622.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini237 – 338102Cadherin 1PROSITE-ProRule annotationAdd
BLAST
Domaini339 – 449111Cadherin 2PROSITE-ProRule annotationAdd
BLAST
Domaini444 – 554111Cadherin 3PROSITE-ProRule annotationAdd
BLAST
Domaini551 – 674124Cadherin 4PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 4 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG74757.
GeneTreeiENSGT00650000093370.
HOGENOMiHOG000111287.
InParanoidiA6H8M9.
KOiK16504.
OMAiPPFQELT.
OrthoDBiEOG744TBP.
PhylomeDBiA6H8M9.
TreeFamiTF341878.

Family and domain databases

Gene3Di2.60.40.60. 3 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 2 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 4 hits.
PROSITEiPS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A6H8M9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLLRLLVFL FAPVVSDLCS LPCFINVSES QGPGTVLQFL SFNCSSYTPT
60 70 80 90 100
PTLELLNVQP PTTFFNPPSL ARWQGTYVGK LTLSSSAQLD ALMVNHYKVQ
110 120 130 140 150
LKFTCGNHVM EGSLSVDVQR DLSHIQCAGQ FASPAGEMIQ VPETVTPGAR
160 170 180 190 200
LYTLLLPGLE LHGAQMSIIS AQDLPHFPGP FSINEQGWLQ APSQGLLGQA
210 220 230 240 250
QKVFQLQISV SFGQRQSCQG MVIVKVLPVP SSQVSFLEQA QNITIPENLA
260 270 280 290 300
PGSEVVQVQA RGVDLRYEIL SPVPSPLFSI GRADGVVRTT TPLELARTSG
310 320 330 340 350
TAVSRLQVKA FEQGQLWASA KLNLTMNVQL VNLWPPRCLP ALLVSQIPET
360 370 380 390 400
APVGTVLNTL TCEDPDSVGA TLDYKLWFRS SSNPASLCLY DRVLEVNATL
410 420 430 440 450
DCDTPGACFQ HAASILVLDG GQPQMTTEVP VLVMVTPINE FSPACAPRTF
460 470 480 490 500
RVQEDAAPHT LLGSVVGTDM DYPHDNIEYY TSGGPTTFAV DRLSGEVHLL
510 520 530 540 550
GPLDYEQQRL YRLTVLVIDH GQDQNPNHHL SGSCTITIEV EDVNDHAPEC
560 570 580 590 600
EPPFQELTIY APLGRSVEVT KMSCQIPQEP QRLIYSYSIV GGNSQNRFIL
610 620 630 640 650
QGAILVHSDL VLGPFWPEQP RTYELLICVA DAGPSTPHLS TTATIIVHLV
660 670 680 690 700
PRRASTVATS THRTTVPSTM TPMLVTDTEA FWQPQPWFVV VLTATGALLL
710 720 730 740 750
LALGWLLGRL LQGLAQLLQA PSKPAQALLL NSIQGTEGSI EGFLEAPKME
760 770 780
MSQAPSSVMS LHFDGRAQDS RTGRDYLFNT HTGARRWL
Length:788
Mass (Da):85,827
Last modified:July 24, 2007 - v1
Checksum:iAAC5C9F6908DBF67
GO
Isoform 2 (identifier: A6H8M9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
     136-788: Missing.

Show »
Length:199
Mass (Da):21,388
Checksum:iD42B51E25AEC77AF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti5 – 51R → K.
Corresponds to variant rs13072748 [ dbSNP | Ensembl ].
VAR_039109

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei135 – 1351A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2. 2 PublicationsVSP_031552
Alternative sequencei136 – 788653Missing in isoform 2. 2 PublicationsVSP_031553Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358221 mRNA. Translation: AAQ88588.1.
BC132756 mRNA. Translation: AAI32757.1.
BC146674 mRNA. Translation: AAI46675.1.
CCDSiCCDS46829.1. [A6H8M9-1]
RefSeqiNP_001007541.2. NM_001007540.2. [A6H8M9-1]
UniGeneiHs.363312.

Genome annotation databases

EnsembliENST00000343366; ENSP00000341302; ENSG00000187492. [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492. [A6H8M9-1]
GeneIDi389118.
KEGGihsa:389118.
UCSCiuc003cxp.2. human. [A6H8M9-2]
uc010hkz.3. human. [A6H8M9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358221 mRNA. Translation: AAQ88588.1 .
BC132756 mRNA. Translation: AAI32757.1 .
BC146674 mRNA. Translation: AAI46675.1 .
CCDSi CCDS46829.1. [A6H8M9-1 ]
RefSeqi NP_001007541.2. NM_001007540.2. [A6H8M9-1 ]
UniGenei Hs.363312.

3D structure databases

ProteinModelPortali A6H8M9.
SMRi A6H8M9. Positions 448-622.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei A6H8M9.

Proteomic databases

PaxDbi A6H8M9.
PRIDEi A6H8M9.

Protocols and materials databases

DNASUi 389118.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343366 ; ENSP00000341302 ; ENSG00000187492 . [A6H8M9-2 ]
ENST00000412678 ; ENSP00000391409 ; ENSG00000187492 . [A6H8M9-1 ]
GeneIDi 389118.
KEGGi hsa:389118.
UCSCi uc003cxp.2. human. [A6H8M9-2 ]
uc010hkz.3. human. [A6H8M9-1 ]

Organism-specific databases

CTDi 389118.
GeneCardsi GC03M049828.
HGNCi HGNC:34527. CDHR4.
HPAi HPA043330.
neXtProti NX_A6H8M9.
PharmGKBi PA165696944.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG74757.
GeneTreei ENSGT00650000093370.
HOGENOMi HOG000111287.
InParanoidi A6H8M9.
KOi K16504.
OMAi PPFQELT.
OrthoDBi EOG744TBP.
PhylomeDBi A6H8M9.
TreeFami TF341878.

Miscellaneous databases

GenomeRNAii 389118.
NextBioi 102601.
PROi A6H8M9.

Gene expression databases

Bgeei A6H8M9.
CleanExi HS_CDH29.
ExpressionAtlasi A6H8M9. baseline.
Genevestigatori A6H8M9.

Family and domain databases

Gene3Di 2.60.40.60. 3 hits.
InterProi IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view ]
Pfami PF00028. Cadherin. 1 hit.
[Graphical view ]
PRINTSi PR00205. CADHERIN.
SMARTi SM00112. CA. 2 hits.
[Graphical view ]
SUPFAMi SSF49313. SSF49313. 4 hits.
PROSITEi PS00232. CADHERIN_1. 1 hit.
PS50268. CADHERIN_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

Entry informationi

Entry nameiCDHR4_HUMAN
AccessioniPrimary (citable) accession number: A6H8M9
Secondary accession number(s): Q6UXT0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 24, 2007
Last modified: October 29, 2014
This is version 66 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3