Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rab GTPase-activating protein 1-like

Gene

Rabgap1l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei580Arginine fingerBy similarity1
Sitei621Glutamine fingerBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Rab GTPase-activating protein 1-like
Gene namesi
Name:Rabgap1lImported
Synonyms:HhlImported, Kiaa0471Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1352507. Rabgap1l.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003480551 – 815Rab GTPase-activating protein 1-likeAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei471PhosphothreonineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei490PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiA6H6A9.
MaxQBiA6H6A9.
PaxDbiA6H6A9.
PeptideAtlasiA6H6A9.
PRIDEiA6H6A9.

PTM databases

iPTMnetiA6H6A9.
PhosphoSitePlusiA6H6A9.

Expressioni

Tissue specificityi

Expressed in embryonic heart and liver, and in hemopoietic cells.1 Publication

Gene expression databases

BgeeiENSMUSG00000026721.
ExpressionAtlasiA6H6A9. baseline and differential.
GenevisibleiA6H6A9. MM.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028049.

Structurei

3D structure databases

ProteinModelPortaliA6H6A9.
SMRiA6H6A9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini126 – 282PIDPROSITE-ProRule annotationAdd BLAST157
Domaini538 – 724Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST187

Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site.By similarity

Sequence similaritiesi

Contains 1 PID domain.PROSITE-ProRule annotation
Contains 1 Rab-GAP TBC domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1102. Eukaryota.
COG5210. LUCA.
GeneTreeiENSGT00750000117238.
HOVERGENiHBG063892.
InParanoidiA6H6A9.
KOiK20284.
OMAiDTEGDGQ.
OrthoDBiEOG091G0AIH.
PhylomeDBiA6H6A9.
TreeFamiTF317184.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR022164. Kinesin-like.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view]
PfamiPF12473. DUF3694. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 12 Publications (identifier: A6H6A9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVRASFQKV SGSSDSVATL NSEEFVLVSQ HTDATSIKDD GKPQLKIASN
60 70 80 90 100
GDEQLEKAME EILRDSEKGQ SGLPVDCQGS SEISDCPFGD VPASQTTKPP
110 120 130 140 150
LQLILDPSNT EISTPRPSSP SRFPEEDSVL FNKLTYLGCM KVSSPRSEVE
160 170 180 190 200
ALRAMATMRA SSQYPFAVTL YVPNVPEGSV RIIDQSSNVE IASFPIYKVL
210 220 230 240 250
FCARGHDGTA ESNCFAFTES SHGSEEFQIH VFSCEIKEAV SRILYSFCTA
260 270 280 290 300
FKRSSRQVSD VKDSVIPTPD SDVFTFSVSL EVKEDDGKGN FSPVPKDRDK
310 320 330 340 350
FYFKIKQGIE KKVVITVQQL SNKELAIERC FGMLLSPGRN VKNSDMHLLD
360 370 380 390 400
MESMGKSYDG RAYVITGMWN PNAPIFLALN EETPKDKRVY MTVAVDMVVT
410 420 430 440 450
EVVEPVRFLL ETVVRVYPAN ERFWYFSRKT FTETFFMRLK QSEGKGHSSA
460 470 480 490 500
GDAIYEVVSL QRESDKEEPI TPTSAGGPMS PQEDEAEEES DNELSSGTGD
510 520 530 540 550
VSKDCPEKIL YSWGELLGRW HNNLGGRPKG LFTLVKSGVP EALRAEVWQL
560 570 580 590 600
LAGCHDNQEM LDKYRILITK DSAQESVITR DIHRTFPAHD YFKDTGGDGQ
610 620 630 640 650
ESLYKICKAY SVFDEDIGYC QGQSFLAAVL LLHMPEEQAF CVLVTIMYGY
660 670 680 690 700
KLRDLYRNNF EDLHCKFYQL EKLMQEQLPD LYSHFCDLNL EAHMYASQWF
710 720 730 740 750
LTLFTAKFPL CMVFHIIDLL LCEGLNIIFH VALALLKTSK EDLLQADFEG
760 770 780 790 800
ALKFFRVQLP KRYRAEENAR RLMEQACNIK VPTKKLKKYE KEYQAMRENQ
810
LQQEDPMDRY KFVYL
Length:815
Mass (Da):92,404
Last modified:July 24, 2007 - v1
Checksum:i28AA916BF9BA3F0E
GO
Isoform 21 Publication (identifier: A6H6A9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MEVRASFQKVSGSSDSVATLNSEEFVLVSQ → ME
     489-505: ESDNELSSGTGDVSKDC → DPGHASPDTVGFLTLFL
     506-815: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:477
Mass (Da):53,068
Checksum:iDB28B8D4939AC348
GO
Isoform 32 Publications (identifier: A6H6A9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-681: Missing.
     682-737: YSHFCDLNLE...IFHVALALLK → MEEGVPCPAP...HRLFVPRLLA
     812-815: FVYL → RENRRLQEAS...QAPQPPKEST

Show »
Length:370
Mass (Da):42,754
Checksum:iF5C6214242E789B9
GO
Isoform 41 Publication (identifier: A6H6A9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-743: Missing.
     744-780: LQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIK → MMEEISIMVAYDAHVFSQLHDEDFLTSLVATSKPRSM

Show »
Length:72
Mass (Da):8,652
Checksum:iF3D99B7B2FEAF43B
GO

Sequence cautioni

The sequence AAF24092 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAF24092 differs from that shown. Reason: Frameshift at positions 145, 153, 156 and 354.Curated
The sequence AAF24092 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti4R → G in AAF24092 (PubMed:10585558).Curated1
Sequence conflicti108S → C in BAC29189 (PubMed:16141072).Curated1
Sequence conflicti208G → E in AAF24092 (PubMed:10585558).Curated1
Sequence conflicti303F → I in AAF24092 (PubMed:10585558).Curated1
Sequence conflicti384 – 386PKD → LSQ in AAF24092 (PubMed:10585558).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0529251 – 743Missing in isoform 4. 1 PublicationAdd BLAST743
Alternative sequenceiVSP_0529261 – 681Missing in isoform 3. 2 PublicationsAdd BLAST681
Alternative sequenceiVSP_0529271 – 30MEVRA…VLVSQ → ME in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_052928489 – 505ESDNE…VSKDC → DPGHASPDTVGFLTLFL in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_052929506 – 815Missing in isoform 2. 1 PublicationAdd BLAST310
Alternative sequenceiVSP_052930682 – 737YSHFC…LALLK → MEEGVPCPAPAAKLTPPVKK SQDMHDERSKLVNEYACRVL ELLGMGHRLFVPRLLA in isoform 3. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_052931744 – 780LQADF…ACNIK → MMEEISIMVAYDAHVFSQLH DEDFLTSLVATSKPRSM in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_052932812 – 815FVYL → RENRRLQEASMRLEQENDDL AHELVTSKIALRNDLDQAED KADVLNKELLFTKQRLVETE EEKRKQEEETAQLKEVFRKQ LEKAEYEIKKTTAIIAEYKQ ICSQLSTRLEKQQAASKEEL EAVKGKMMACKHCSDIFSKE GALKPVAVNREDQGLEADDE KDSLKKQLREMELELAQTKL QLVEAKCKIQELEHQRGALM NEIQAAKNSWFSKTLNSIKT ATGTQPLQPPQAPQPPKEST in isoform 3. 2 Publications4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034019 mRNA. Translation: BAC28549.1.
AK035796 mRNA. Translation: BAC29189.1.
AK147634 mRNA. Translation: BAE28037.1.
BC038651 mRNA. Translation: AAH38651.1.
BC145811 mRNA. Translation: AAI45812.1.
BC145813 mRNA. Translation: AAI45814.1.
AF118565 mRNA. Translation: AAF24092.1. Sequence problems.
AK122292 mRNA. Translation: BAC65574.1.
CCDSiCCDS15407.1. [A6H6A9-3]
CCDS15408.1. [A6H6A9-1]
RefSeqiNP_001033710.1. NM_001038621.2. [A6H6A9-3]
NP_038890.3. NM_013862.5. [A6H6A9-1]
XP_006496946.1. XM_006496883.3. [A6H6A9-4]
UniGeneiMm.25833.

Genome annotation databases

EnsembliENSMUST00000028049; ENSMUSP00000028049; ENSMUSG00000026721. [A6H6A9-1]
ENSMUST00000028052; ENSMUSP00000028052; ENSMUSG00000026721. [A6H6A9-3]
ENSMUST00000195442; ENSMUSP00000141666; ENSMUSG00000026721. [A6H6A9-2]
GeneIDi29809.
KEGGimmu:29809.
UCSCiuc007deh.1. mouse. [A6H6A9-3]
uc007dej.2. mouse. [A6H6A9-1]
uc007dek.1. mouse. [A6H6A9-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034019 mRNA. Translation: BAC28549.1.
AK035796 mRNA. Translation: BAC29189.1.
AK147634 mRNA. Translation: BAE28037.1.
BC038651 mRNA. Translation: AAH38651.1.
BC145811 mRNA. Translation: AAI45812.1.
BC145813 mRNA. Translation: AAI45814.1.
AF118565 mRNA. Translation: AAF24092.1. Sequence problems.
AK122292 mRNA. Translation: BAC65574.1.
CCDSiCCDS15407.1. [A6H6A9-3]
CCDS15408.1. [A6H6A9-1]
RefSeqiNP_001033710.1. NM_001038621.2. [A6H6A9-3]
NP_038890.3. NM_013862.5. [A6H6A9-1]
XP_006496946.1. XM_006496883.3. [A6H6A9-4]
UniGeneiMm.25833.

3D structure databases

ProteinModelPortaliA6H6A9.
SMRiA6H6A9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028049.

PTM databases

iPTMnetiA6H6A9.
PhosphoSitePlusiA6H6A9.

Proteomic databases

EPDiA6H6A9.
MaxQBiA6H6A9.
PaxDbiA6H6A9.
PeptideAtlasiA6H6A9.
PRIDEiA6H6A9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028049; ENSMUSP00000028049; ENSMUSG00000026721. [A6H6A9-1]
ENSMUST00000028052; ENSMUSP00000028052; ENSMUSG00000026721. [A6H6A9-3]
ENSMUST00000195442; ENSMUSP00000141666; ENSMUSG00000026721. [A6H6A9-2]
GeneIDi29809.
KEGGimmu:29809.
UCSCiuc007deh.1. mouse. [A6H6A9-3]
uc007dej.2. mouse. [A6H6A9-1]
uc007dek.1. mouse. [A6H6A9-2]

Organism-specific databases

CTDi9910.
MGIiMGI:1352507. Rabgap1l.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1102. Eukaryota.
COG5210. LUCA.
GeneTreeiENSGT00750000117238.
HOVERGENiHBG063892.
InParanoidiA6H6A9.
KOiK20284.
OMAiDTEGDGQ.
OrthoDBiEOG091G0AIH.
PhylomeDBiA6H6A9.
TreeFamiTF317184.

Miscellaneous databases

ChiTaRSiRabgap1l. mouse.
PROiA6H6A9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026721.
ExpressionAtlasiA6H6A9. baseline and differential.
GenevisibleiA6H6A9. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR022164. Kinesin-like.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view]
PfamiPF12473. DUF3694. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRBG1L_MOUSE
AccessioniPrimary (citable) accession number: A6H6A9
Secondary accession number(s): Q3UH20
, Q80TZ4, Q8BZD2, Q8BZP0, Q8CFI6, Q9QY69
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 24, 2007
Last modified: November 2, 2016
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.