Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 3E

Gene

HTR3E

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

BioCyciZFISH:G66-33727-MONOMER.
ReactomeiR-HSA-975298. Ligand-gated ion channel transport.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3E
Short name:
5-HT3-E
Short name:
5-HT3E
Alternative name(s):
Serotonin receptor 3E
Gene namesi
Name:HTR3E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:24005. HTR3E.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 248ExtracellularSequence analysisAdd BLAST223
Transmembranei249 – 269Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini270 – 282CytoplasmicSequence analysisAdd BLAST13
Transmembranei283 – 303Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini304 – 307ExtracellularSequence analysis4
Transmembranei308 – 328Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini329 – 433CytoplasmicSequence analysisAdd BLAST105
Transmembranei434 – 454Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini455 – 456ExtracellularSequence analysis2

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi285242.
OpenTargetsiENSG00000186038.
PharmGKBiPA134900226.

Chemistry databases

ChEMBLiCHEMBL2094132.
DrugBankiDB01049. Ergoloid mesylate.
DB00898. Ethanol.

Polymorphism and mutation databases

BioMutaiHTR3E.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000031229426 – 4565-hydroxytryptamine receptor 3EAdd BLAST431

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi162 ↔ 176By similarity
Glycosylationi175N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiA5X5Y0.
PRIDEiA5X5Y0.

PTM databases

iPTMnetiA5X5Y0.
PhosphoSitePlusiA5X5Y0.

Expressioni

Tissue specificityi

Expressed in adult colon and intestine.2 Publications

Gene expression databases

BgeeiENSG00000186038.
CleanExiHS_HTR3E.
ExpressionAtlasiA5X5Y0. baseline and differential.

Organism-specific databases

HPAiHPA049764.

Interactioni

Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
HTR3AP460985EBI-11174612,EBI-9008743

Protein-protein interaction databases

BioGridi130056. 6 interactors.
IntActiA5X5Y0. 1 interactor.
STRINGi9606.ENSP00000335511.

Chemistry databases

BindingDBiA5X5Y0.

Structurei

3D structure databases

ProteinModelPortaliA5X5Y0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3645. Eukaryota.
ENOG410XQGR. LUCA.
GeneTreeiENSGT00790000122957.
HOGENOMiHOG000241519.
HOVERGENiHBG106638.
InParanoidiA5X5Y0.
KOiK04819.
OMAiSYREHRV.
OrthoDBiEOG091G042C.
PhylomeDBiA5X5Y0.
TreeFamiTF315605.

Family and domain databases

Gene3Di1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
PRINTSiPR00252. NRIONCHANNEL.
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A5X5Y0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGSWFHRKR FSFYLLLGFL LQGRGVTFTI NCSGFGQHGA DPTALNSVFN
60 70 80 90 100
RKPFRPVTNI SVPTQVNISF AMSAILDVNE QLHLLSSFLW LEMVWDNPFI
110 120 130 140 150
SWNPEECEGI TKMSMAAKNL WLPDIFIIEL MDVDKTPKGL TAYVSNEGRI
160 170 180 190 200
RYKKPMKVDS ICNLDIFYFP FDQQNCTLTF SSFLYTVDSM LLDMEKEVWE
210 220 230 240 250
ITDASRNILQ THGEWELLGL SKATAKLSRG GNLYDQIVFY VAIRRRPSLY
260 270 280 290 300
VINLLVPSGF LVAIDALSFY LPVKSGNRVP FKITLLLGYN VFLLMMSDLL
310 320 330 340 350
PTSGTPLIGV YFALCLSLMV GSLLETIFIT HLLHVATTQP PPLPRWLHSL
360 370 380 390 400
LLHCNSPGRC CPTAPQKENK GPGLTPTHLP GVKEPEVSAG QMPGPAEAEL
410 420 430 440 450
TGGSEWTRAQ REHEAQKQHS VELWLQFSHA MDAMLFRLYL LFMASSIITV

ICLWNT
Length:456
Mass (Da):51,438
Last modified:July 10, 2007 - v1
Checksum:i4BFA6561BA309E83
GO
Isoform 2 (identifier: A5X5Y0-2) [UniParc]FASTAAdd to basket
Also known as: 5-HT3c1

The sequence of this isoform differs from the canonical sequence as follows:
     79-93: Missing.

Show »
Length:441
Mass (Da):49,596
Checksum:iF604941E9F3849D6
GO
Isoform 3 (identifier: A5X5Y0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT

Show »
Length:471
Mass (Da):52,808
Checksum:i94A7B8D13492E8F1
GO
Isoform 4 (identifier: A5X5Y0-4) [UniParc]FASTAAdd to basket
Also known as: 5-HT3c1 long

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.

Show »
Length:456
Mass (Da):50,965
Checksum:i81FD94F996ED344D
GO
Isoform 5 (identifier: A5X5Y0-6) [UniParc]FASTAAdd to basket
Also known as: HTR3E_V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.
     129-129: E → ELCVSRAGQREVPSPGSHRDHSLPLGP

Show »
Length:482
Mass (Da):53,700
Checksum:iDDE59C2099D78219
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti44A → T in AAI01183 (PubMed:15489334).Curated1
Sequence conflicti44A → T in AAI01184 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03748171A → T.1 PublicationCorresponds to variant rs7627615dbSNPEnsembl.1
Natural variantiVAR_037482430A → T.Corresponds to variant rs13324468dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0298031 – 22MEGSW…GFLLQ → MLAFILSRATPRPALGPLSY REHRVALLHLTHSMSTT in isoform 3, isoform 4 and isoform 5. 5 PublicationsAdd BLAST22
Alternative sequenceiVSP_02980479 – 93Missing in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_045573129E → ELCVSRAGQREVPSPGSHRD HSLPLGP in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY349352 mRNA. Translation: AAQ93476.1.
AY349353 mRNA. Translation: AAQ93477.1.
AY159813 mRNA. Translation: AAO38167.2.
DQ644022 mRNA. Translation: ABG35128.1.
EU165354 mRNA. Translation: ABW05298.1.
AC131235 Genomic DNA. No translation available.
BC101182 mRNA. Translation: AAI01183.1.
BC101183 mRNA. Translation: AAI01184.1.
BC101185 mRNA. Translation: AAI01186.1.
CCDSiCCDS3251.1. [A5X5Y0-3]
CCDS58868.1. [A5X5Y0-1]
CCDS58869.1. [A5X5Y0-2]
CCDS58870.1. [A5X5Y0-4]
CCDS58871.1. [A5X5Y0-6]
RefSeqiNP_001243542.1. NM_001256613.1. [A5X5Y0-1]
NP_001243543.1. NM_001256614.1. [A5X5Y0-6]
NP_872395.2. NM_182589.2. [A5X5Y0-3]
NP_938055.1. NM_198313.2. [A5X5Y0-2]
NP_938056.1. NM_198314.2. [A5X5Y0-4]
UniGeneiHs.449179.

Genome annotation databases

EnsembliENST00000335304; ENSP00000335511; ENSG00000186038. [A5X5Y0-3]
ENST00000415389; ENSP00000401444; ENSG00000186038. [A5X5Y0-1]
ENST00000425359; ENSP00000401900; ENSG00000186038. [A5X5Y0-2]
ENST00000436361; ENSP00000395833; ENSG00000186038. [A5X5Y0-4]
ENST00000440596; ENSP00000406050; ENSG00000186038. [A5X5Y0-6]
GeneIDi285242.
KEGGihsa:285242.
UCSCiuc003fml.5. human. [A5X5Y0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY349352 mRNA. Translation: AAQ93476.1.
AY349353 mRNA. Translation: AAQ93477.1.
AY159813 mRNA. Translation: AAO38167.2.
DQ644022 mRNA. Translation: ABG35128.1.
EU165354 mRNA. Translation: ABW05298.1.
AC131235 Genomic DNA. No translation available.
BC101182 mRNA. Translation: AAI01183.1.
BC101183 mRNA. Translation: AAI01184.1.
BC101185 mRNA. Translation: AAI01186.1.
CCDSiCCDS3251.1. [A5X5Y0-3]
CCDS58868.1. [A5X5Y0-1]
CCDS58869.1. [A5X5Y0-2]
CCDS58870.1. [A5X5Y0-4]
CCDS58871.1. [A5X5Y0-6]
RefSeqiNP_001243542.1. NM_001256613.1. [A5X5Y0-1]
NP_001243543.1. NM_001256614.1. [A5X5Y0-6]
NP_872395.2. NM_182589.2. [A5X5Y0-3]
NP_938055.1. NM_198313.2. [A5X5Y0-2]
NP_938056.1. NM_198314.2. [A5X5Y0-4]
UniGeneiHs.449179.

3D structure databases

ProteinModelPortaliA5X5Y0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130056. 6 interactors.
IntActiA5X5Y0. 1 interactor.
STRINGi9606.ENSP00000335511.

Chemistry databases

BindingDBiA5X5Y0.
ChEMBLiCHEMBL2094132.
DrugBankiDB01049. Ergoloid mesylate.
DB00898. Ethanol.

PTM databases

iPTMnetiA5X5Y0.
PhosphoSitePlusiA5X5Y0.

Polymorphism and mutation databases

BioMutaiHTR3E.

Proteomic databases

PaxDbiA5X5Y0.
PRIDEiA5X5Y0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335304; ENSP00000335511; ENSG00000186038. [A5X5Y0-3]
ENST00000415389; ENSP00000401444; ENSG00000186038. [A5X5Y0-1]
ENST00000425359; ENSP00000401900; ENSG00000186038. [A5X5Y0-2]
ENST00000436361; ENSP00000395833; ENSG00000186038. [A5X5Y0-4]
ENST00000440596; ENSP00000406050; ENSG00000186038. [A5X5Y0-6]
GeneIDi285242.
KEGGihsa:285242.
UCSCiuc003fml.5. human. [A5X5Y0-1]

Organism-specific databases

CTDi285242.
DisGeNETi285242.
GeneCardsiHTR3E.
HGNCiHGNC:24005. HTR3E.
HPAiHPA049764.
MIMi610123. gene.
neXtProtiNX_A5X5Y0.
OpenTargetsiENSG00000186038.
PharmGKBiPA134900226.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3645. Eukaryota.
ENOG410XQGR. LUCA.
GeneTreeiENSGT00790000122957.
HOGENOMiHOG000241519.
HOVERGENiHBG106638.
InParanoidiA5X5Y0.
KOiK04819.
OMAiSYREHRV.
OrthoDBiEOG091G042C.
PhylomeDBiA5X5Y0.
TreeFamiTF315605.

Enzyme and pathway databases

BioCyciZFISH:G66-33727-MONOMER.
ReactomeiR-HSA-975298. Ligand-gated ion channel transport.

Miscellaneous databases

GeneWikiiHTR3E.
GenomeRNAii285242.
PROiA5X5Y0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186038.
CleanExiHS_HTR3E.
ExpressionAtlasiA5X5Y0. baseline and differential.

Family and domain databases

Gene3Di1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
PRINTSiPR00252. NRIONCHANNEL.
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry namei5HT3E_HUMAN
AccessioniPrimary (citable) accession number: A5X5Y0
Secondary accession number(s): A8IKD7
, E9PGF1, Q495G1, Q495G3, Q6V706, Q6V707, Q7Z6B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: July 10, 2007
Last modified: November 2, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.