A5X5Y0 (5HT3E_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 5-hydroxytryptamine receptor 3E Short name=5-HT3-E Short name=5-HT3E Alternative name(s): Serotonin receptor 3E | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 456 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. |
| Subunit structure | Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex. Ref.3 |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A. Ref.3 Ref.4 |
| Tissue specificity | |
| Sequence similarities | Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3E sub-subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | Ion channel Ligand-gated ion channel Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ion transmembrane transport Traceable author statement. Source: Reactome |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneTraceable author statement. Source: Reactome postsynaptic membraneInferred from electronic annotation. Source: InterPro |
| Molecular_function | extracellular ligand-gated ion channel activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A5X5Y0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A5X5Y0-2) Also known as: 5-HT3c1; The sequence of this isoform differs from the canonical sequence as follows: 79-93: Missing. | ||||||
| Isoform 3 (identifier: A5X5Y0-3) The sequence of this isoform differs from the canonical sequence as follows: 1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT | ||||||
| Isoform 4 (identifier: A5X5Y0-4) Also known as: 5-HT3c1 long; The sequence of this isoform differs from the canonical sequence as follows: 1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT 79-93: Missing. | ||||||
| Isoform 5 (identifier: A5X5Y0-6) Also known as: HTR3E_V3; The sequence of this isoform differs from the canonical sequence as follows: 1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT 79-93: Missing. 129-129: E → ELCVSRAGQREVPSPGSHRDHSLPLGP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||
| Chain | 26 – 456 | 431 | 5-hydroxytryptamine receptor 3E | PRO_0000312294 | |||||||
Regions | |||||||||||
| Topological domain | 26 – 248 | 223 | Extracellular Potential | ||||||||
| Transmembrane | 249 – 269 | 21 | Helical; Name=1; Potential | ||||||||
| Topological domain | 270 – 282 | 13 | Cytoplasmic Potential | ||||||||
| Transmembrane | 283 – 303 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 304 – 307 | 4 | Extracellular Potential | ||||||||
| Transmembrane | 308 – 328 | 21 | Helical; Name=3; Potential | ||||||||
| Topological domain | 329 – 433 | 105 | Cytoplasmic Potential | ||||||||
| Transmembrane | 434 – 454 | 21 | Helical; Name=4; Potential | ||||||||
| Topological domain | 455 – 456 | 2 | Extracellular Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 175 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 162 ↔ 176 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 22 | 22 | MEGSW…GFLLQ → MLAFILSRATPRPALGPLSY REHRVALLHLTHSMSTT in isoform 3, isoform 4 and isoform 5. | VSP_029803 | |||||||
| Alternative sequence | 79 – 93 | 15 | Missing in isoform 2, isoform 4 and isoform 5. | VSP_029804 | |||||||
| Alternative sequence | 129 | 1 | E → ELCVSRAGQREVPSPGSHRD HSLPLGP in isoform 5. | VSP_045573 | |||||||
| Natural variant | 71 | 1 | A → T. Ref.4 Corresponds to variant rs7627615 [ dbSNP | Ensembl ]. | VAR_037481 | |||||||
| Natural variant | 430 | 1 | A → T. Corresponds to variant rs13324468 [ dbSNP | Ensembl ]. | VAR_037482 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 44 | 1 | A → T in AAI01183. Ref.6 | ||||||||
| Sequence conflict | 44 | 1 | A → T in AAI01184. Ref.6 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E." Niesler B., Frank B., Kapeller J., Rappold G.A. Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. |
| [2] | "A cluster of novel serotonin receptor 3-like genes on human chromosome 3." Karnovsky A.M., Gotow L.F., McKinley D.D., Piechan J.L., Ruble C.L., Mills C.J., Schellin K.A.B., Slightom J.L., Fitzgerald L.R., Benjamin C.W., Roberds S.L. Gene 319:137-148(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), TISSUE SPECIFICITY. |
| [3] | "Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E." Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M. Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), SUBUNIT, SUBCELLULAR LOCATION. |
| [4] | "Characterisation of 5-HT3C, 5-HT3D and 5-HT3E receptor subunits: evolution, distribution and function." Holbrook J.D., Gill C.H., Zebda N., Spencer J.P., Leyland R., Rance K.H., Trinh H., Balmer G., Kelly F.M., Yusaf S.P., Courtenay N., Luck J., Rhodes A., Modha S., Moore S.E., Sanger G.J., Gunthorpe M.J. J. Neurochem. 108:384-396(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANT THR-71. |
| [5] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY349352 mRNA. Translation: AAQ93476.1. AY349353 mRNA. Translation: AAQ93477.1. AY159813 mRNA. Translation: AAO38167.2. DQ644022 mRNA. Translation: ABG35128.1. EU165354 mRNA. Translation: ABW05298.1. AC131235 Genomic DNA. No translation available. BC101182 mRNA. Translation: AAI01183.1. BC101183 mRNA. Translation: AAI01184.1. BC101185 mRNA. Translation: AAI01186.1. |
| IPI | IPI00376255. IPI00876853. IPI00877063. IPI00877086. IPI00877142. |
| RefSeq | NP_001243542.1. NM_001256613.1. NP_001243543.1. NM_001256614.1. NP_872395.2. NM_182589.2. NP_938055.1. NM_198313.2. NP_938056.1. NM_198314.2. |
| UniGene | Hs.449179. |
3D structure databases | |
| ProteinModelPortal | A5X5Y0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000335511. |
Proteomic databases | |
| PaxDb | A5X5Y0. |
| PRIDE | A5X5Y0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000335304; ENSP00000335511; ENSG00000186038. ENST00000415389; ENSP00000401444; ENSG00000186038. ENST00000425359; ENSP00000401900; ENSG00000186038. ENST00000436361; ENSP00000395833; ENSG00000186038. ENST00000440596; ENSP00000406050; ENSG00000186038. |
| GeneID | 285242. |
| KEGG | hsa:285242. |
| UCSC | uc003fml.4. human. uc003fmm.3. human. uc003fmn.3. human. uc010hxq.3. human. |
Organism-specific databases | |
| CTD | 285242. |
| GeneCards | GC03P183814. |
| HGNC | HGNC:24005. HTR3E. |
| MIM | 610123. gene. |
| neXtProt | NX_A5X5Y0. |
| PharmGKB | PA134900226. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG316889. |
| HOGENOM | HOG000241519. |
| HOVERGEN | HBG106638. |
| InParanoid | A5X5Y0. |
| KO | K04819. |
| OrthoDB | EOG4R5034. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | A5X5Y0. |
| CleanEx | HS_HTR3E. |
| Genevestigator | A5X5Y0. |
Family and domain databases | |
| Gene3D | 2.70.170.10. 1 hit. |
| InterPro | IPR006202. Neur_chan_lig-bd. IPR006201. Neur_channel. IPR006029. Neurotrans-gated_channel_TM. IPR018000. Neurotransmitter_ion_chnl_CS. [Graphical view] |
| PANTHER | PTHR18945. PTHR18945. 1 hit. |
| Pfam | PF02931. Neur_chan_LBD. 1 hit. PF02932. Neur_chan_memb. 1 hit. [Graphical view] |
| PRINTS | PR00252. NRIONCHANNEL. |
| SUPFAM | SSF90112. Neu_channel_TM. 1 hit. SSF63712. Neur_chan_LBD. 1 hit. |
| PROSITE | PS00236. NEUROTR_ION_CHANNEL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | A5X5Y0. |
| ChEMBL | CHEMBL3812. |
| GenomeRNAi | 285242. |
| NextBio | 95380. |
| SOURCE | Search... |
Entry information
| Entry name | 5HT3E_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A5X5Y0 Secondary accession number(s): A8IKD7 Q7Z6B2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
