SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A5X5Y0

- 5HT3E_HUMAN

UniProt

A5X5Y0 - 5HT3E_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
5-hydroxytryptamine receptor 3E
Gene
HTR3E
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

GO - Molecular functioni

  1. extracellular ligand-gated ion channel activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. ion transmembrane transport Source: Reactome
  2. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_25387. Ligand-gated ion channel transport.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3E
Short name:
5-HT3-E
Short name:
5-HT3E
Alternative name(s):
Serotonin receptor 3E
Gene namesi
Name:HTR3E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:24005. HTR3E.

Subcellular locationi

Cell membrane; Multi-pass membrane protein
Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 248223Extracellular Reviewed prediction
Add
BLAST
Transmembranei249 – 26921Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini270 – 28213Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei283 – 30321Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini304 – 3074Extracellular Reviewed prediction
Transmembranei308 – 32821Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini329 – 433105Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei434 – 45421Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini455 – 4562Extracellular Reviewed prediction

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134900226.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525 Reviewed prediction
Add
BLAST
Chaini26 – 4564315-hydroxytryptamine receptor 3E
PRO_0000312294Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi162 ↔ 176 By similarity
Glycosylationi175 – 1751N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiA5X5Y0.
PRIDEiA5X5Y0.

Expressioni

Tissue specificityi

Expressed in adult colon and intestine.2 Publications

Gene expression databases

CleanExiHS_HTR3E.
GenevestigatoriA5X5Y0.

Organism-specific databases

HPAiHPA049764.

Interactioni

Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

Protein-protein interaction databases

STRINGi9606.ENSP00000335511.

Structurei

3D structure databases

ProteinModelPortaliA5X5Y0.
SMRiA5X5Y0. Positions 52-324.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG316889.
HOGENOMiHOG000241519.
HOVERGENiHBG106638.
InParanoidiA5X5Y0.
KOiK04819.
OMAiATKNLWL.
OrthoDBiEOG7XPZ5D.
PhylomeDBiA5X5Y0.
TreeFamiTF315605.

Family and domain databases

Gene3Di1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
PRINTSiPR00252. NRIONCHANNEL.
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A5X5Y0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEGSWFHRKR FSFYLLLGFL LQGRGVTFTI NCSGFGQHGA DPTALNSVFN    50
RKPFRPVTNI SVPTQVNISF AMSAILDVNE QLHLLSSFLW LEMVWDNPFI 100
SWNPEECEGI TKMSMAAKNL WLPDIFIIEL MDVDKTPKGL TAYVSNEGRI 150
RYKKPMKVDS ICNLDIFYFP FDQQNCTLTF SSFLYTVDSM LLDMEKEVWE 200
ITDASRNILQ THGEWELLGL SKATAKLSRG GNLYDQIVFY VAIRRRPSLY 250
VINLLVPSGF LVAIDALSFY LPVKSGNRVP FKITLLLGYN VFLLMMSDLL 300
PTSGTPLIGV YFALCLSLMV GSLLETIFIT HLLHVATTQP PPLPRWLHSL 350
LLHCNSPGRC CPTAPQKENK GPGLTPTHLP GVKEPEVSAG QMPGPAEAEL 400
TGGSEWTRAQ REHEAQKQHS VELWLQFSHA MDAMLFRLYL LFMASSIITV 450
ICLWNT 456
Length:456
Mass (Da):51,438
Last modified:July 10, 2007 - v1
Checksum:i4BFA6561BA309E83
GO
Isoform 2 (identifier: A5X5Y0-2) [UniParc]FASTAAdd to Basket

Also known as: 5-HT3c1

The sequence of this isoform differs from the canonical sequence as follows:
     79-93: Missing.

Show »
Length:441
Mass (Da):49,596
Checksum:iF604941E9F3849D6
GO
Isoform 3 (identifier: A5X5Y0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT

Show »
Length:471
Mass (Da):52,808
Checksum:i94A7B8D13492E8F1
GO
Isoform 4 (identifier: A5X5Y0-4) [UniParc]FASTAAdd to Basket

Also known as: 5-HT3c1 long

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.

Show »
Length:456
Mass (Da):50,965
Checksum:i81FD94F996ED344D
GO
Isoform 5 (identifier: A5X5Y0-6) [UniParc]FASTAAdd to Basket

Also known as: HTR3E_V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.
     129-129: E → ELCVSRAGQREVPSPGSHRDHSLPLGP

Show »
Length:482
Mass (Da):53,700
Checksum:iDDE59C2099D78219
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti71 – 711A → T.1 Publication
Corresponds to variant rs7627615 [ dbSNP | Ensembl ].
VAR_037481
Natural varianti430 – 4301A → T.
Corresponds to variant rs13324468 [ dbSNP | Ensembl ].
VAR_037482

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2222MEGSW…GFLLQ → MLAFILSRATPRPALGPLSY REHRVALLHLTHSMSTT in isoform 3, isoform 4 and isoform 5.
VSP_029803Add
BLAST
Alternative sequencei79 – 9315Missing in isoform 2, isoform 4 and isoform 5.
VSP_029804Add
BLAST
Alternative sequencei129 – 1291E → ELCVSRAGQREVPSPGSHRD HSLPLGP in isoform 5.
VSP_045573

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti44 – 441A → T in AAI01183. 1 Publication
Sequence conflicti44 – 441A → T in AAI01184. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY349352 mRNA. Translation: AAQ93476.1.
AY349353 mRNA. Translation: AAQ93477.1.
AY159813 mRNA. Translation: AAO38167.2.
DQ644022 mRNA. Translation: ABG35128.1.
EU165354 mRNA. Translation: ABW05298.1.
AC131235 Genomic DNA. No translation available.
BC101182 mRNA. Translation: AAI01183.1.
BC101183 mRNA. Translation: AAI01184.1.
BC101185 mRNA. Translation: AAI01186.1.
CCDSiCCDS3251.1. [A5X5Y0-3]
CCDS58868.1. [A5X5Y0-1]
CCDS58869.1. [A5X5Y0-2]
CCDS58870.1. [A5X5Y0-4]
CCDS58871.1. [A5X5Y0-6]
RefSeqiNP_001243542.1. NM_001256613.1. [A5X5Y0-1]
NP_001243543.1. NM_001256614.1. [A5X5Y0-6]
NP_872395.2. NM_182589.2. [A5X5Y0-3]
NP_938055.1. NM_198313.2. [A5X5Y0-2]
NP_938056.1. NM_198314.2. [A5X5Y0-4]
XP_005247433.1. XM_005247376.1.
UniGeneiHs.449179.

Genome annotation databases

EnsembliENST00000335304; ENSP00000335511; ENSG00000186038. [A5X5Y0-3]
ENST00000415389; ENSP00000401444; ENSG00000186038. [A5X5Y0-1]
ENST00000425359; ENSP00000401900; ENSG00000186038. [A5X5Y0-2]
ENST00000436361; ENSP00000395833; ENSG00000186038. [A5X5Y0-4]
ENST00000440596; ENSP00000406050; ENSG00000186038. [A5X5Y0-6]
GeneIDi285242.
KEGGihsa:285242.
UCSCiuc003fml.4. human. [A5X5Y0-2]
uc003fmm.3. human. [A5X5Y0-3]
uc003fmn.3. human. [A5X5Y0-4]
uc010hxq.3. human. [A5X5Y0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY349352 mRNA. Translation: AAQ93476.1 .
AY349353 mRNA. Translation: AAQ93477.1 .
AY159813 mRNA. Translation: AAO38167.2 .
DQ644022 mRNA. Translation: ABG35128.1 .
EU165354 mRNA. Translation: ABW05298.1 .
AC131235 Genomic DNA. No translation available.
BC101182 mRNA. Translation: AAI01183.1 .
BC101183 mRNA. Translation: AAI01184.1 .
BC101185 mRNA. Translation: AAI01186.1 .
CCDSi CCDS3251.1. [A5X5Y0-3 ]
CCDS58868.1. [A5X5Y0-1 ]
CCDS58869.1. [A5X5Y0-2 ]
CCDS58870.1. [A5X5Y0-4 ]
CCDS58871.1. [A5X5Y0-6 ]
RefSeqi NP_001243542.1. NM_001256613.1. [A5X5Y0-1 ]
NP_001243543.1. NM_001256614.1. [A5X5Y0-6 ]
NP_872395.2. NM_182589.2. [A5X5Y0-3 ]
NP_938055.1. NM_198313.2. [A5X5Y0-2 ]
NP_938056.1. NM_198314.2. [A5X5Y0-4 ]
XP_005247433.1. XM_005247376.1.
UniGenei Hs.449179.

3D structure databases

ProteinModelPortali A5X5Y0.
SMRi A5X5Y0. Positions 52-324.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000335511.

Chemistry

BindingDBi A5X5Y0.
ChEMBLi CHEMBL2094132.
GuidetoPHARMACOLOGYi 377.

Proteomic databases

PaxDbi A5X5Y0.
PRIDEi A5X5Y0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335304 ; ENSP00000335511 ; ENSG00000186038 . [A5X5Y0-3 ]
ENST00000415389 ; ENSP00000401444 ; ENSG00000186038 . [A5X5Y0-1 ]
ENST00000425359 ; ENSP00000401900 ; ENSG00000186038 . [A5X5Y0-2 ]
ENST00000436361 ; ENSP00000395833 ; ENSG00000186038 . [A5X5Y0-4 ]
ENST00000440596 ; ENSP00000406050 ; ENSG00000186038 . [A5X5Y0-6 ]
GeneIDi 285242.
KEGGi hsa:285242.
UCSCi uc003fml.4. human. [A5X5Y0-2 ]
uc003fmm.3. human. [A5X5Y0-3 ]
uc003fmn.3. human. [A5X5Y0-4 ]
uc010hxq.3. human. [A5X5Y0-1 ]

Organism-specific databases

CTDi 285242.
GeneCardsi GC03P183814.
HGNCi HGNC:24005. HTR3E.
HPAi HPA049764.
MIMi 610123. gene.
neXtProti NX_A5X5Y0.
PharmGKBi PA134900226.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG316889.
HOGENOMi HOG000241519.
HOVERGENi HBG106638.
InParanoidi A5X5Y0.
KOi K04819.
OMAi ATKNLWL.
OrthoDBi EOG7XPZ5D.
PhylomeDBi A5X5Y0.
TreeFami TF315605.

Enzyme and pathway databases

Reactomei REACT_25387. Ligand-gated ion channel transport.

Miscellaneous databases

GeneWikii HTR3E.
GenomeRNAii 285242.
NextBioi 95380.
PROi A5X5Y0.
SOURCEi Search...

Gene expression databases

CleanExi HS_HTR3E.
Genevestigatori A5X5Y0.

Family and domain databases

Gene3Di 1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProi IPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
[Graphical view ]
PANTHERi PTHR18945. PTHR18945. 1 hit.
Pfami PF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view ]
PRINTSi PR00252. NRIONCHANNEL.
SUPFAMi SSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E."
    Niesler B., Frank B., Kapeller J., Rappold G.A.
    Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), TISSUE SPECIFICITY.
  3. "Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E."
    Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M.
    Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), SUBUNIT, SUBCELLULAR LOCATION.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANT THR-71.
  5. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).

Entry informationi

Entry namei5HT3E_HUMAN
AccessioniPrimary (citable) accession number: A5X5Y0
Secondary accession number(s): A8IKD7
, E9PGF1, Q495G1, Q495G3, Q6V706, Q6V707, Q7Z6B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: July 10, 2007
Last modified: September 3, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi