Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A5X5Y0

- 5HT3E_HUMAN

UniProt

A5X5Y0 - 5HT3E_HUMAN

Protein

5-hydroxytryptamine receptor 3E

Gene

HTR3E

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 78 (01 Oct 2014)
      Sequence version 1 (10 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

    GO - Molecular functioni

    1. extracellular ligand-gated ion channel activity Source: InterPro

    GO - Biological processi

    1. ion transmembrane transport Source: Reactome
    2. transmembrane transport Source: Reactome

    Keywords - Molecular functioni

    Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_25387. Ligand-gated ion channel transport.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    5-hydroxytryptamine receptor 3E
    Short name:
    5-HT3-E
    Short name:
    5-HT3E
    Alternative name(s):
    Serotonin receptor 3E
    Gene namesi
    Name:HTR3E
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:24005. HTR3E.

    Subcellular locationi

    Cell membrane 2 Publications; Multi-pass membrane protein 2 Publications
    Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134900226.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 4564315-hydroxytryptamine receptor 3EPRO_0000312294Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi162 ↔ 176By similarity
    Glycosylationi175 – 1751N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiA5X5Y0.
    PRIDEiA5X5Y0.

    Expressioni

    Tissue specificityi

    Expressed in adult colon and intestine.2 Publications

    Gene expression databases

    CleanExiHS_HTR3E.
    GenevestigatoriA5X5Y0.

    Organism-specific databases

    HPAiHPA049764.

    Interactioni

    Subunit structurei

    Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

    Protein-protein interaction databases

    STRINGi9606.ENSP00000335511.

    Structurei

    3D structure databases

    ProteinModelPortaliA5X5Y0.
    SMRiA5X5Y0. Positions 52-324.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini26 – 248223ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini270 – 28213CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini304 – 3074ExtracellularSequence Analysis
    Topological domaini329 – 433105CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini455 – 4562ExtracellularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei249 – 26921Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei283 – 30321Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei308 – 32821Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei434 – 45421Helical; Name=4Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG316889.
    HOGENOMiHOG000241519.
    HOVERGENiHBG106638.
    InParanoidiA5X5Y0.
    KOiK04819.
    OMAiATKNLWL.
    OrthoDBiEOG7XPZ5D.
    PhylomeDBiA5X5Y0.
    TreeFamiTF315605.

    Family and domain databases

    Gene3Di1.20.120.370. 2 hits.
    2.70.170.10. 1 hit.
    InterProiIPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    [Graphical view]
    PANTHERiPTHR18945. PTHR18945. 1 hit.
    PfamiPF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 1 hit.
    [Graphical view]
    PRINTSiPR00252. NRIONCHANNEL.
    SUPFAMiSSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A5X5Y0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEGSWFHRKR FSFYLLLGFL LQGRGVTFTI NCSGFGQHGA DPTALNSVFN    50
    RKPFRPVTNI SVPTQVNISF AMSAILDVNE QLHLLSSFLW LEMVWDNPFI 100
    SWNPEECEGI TKMSMAAKNL WLPDIFIIEL MDVDKTPKGL TAYVSNEGRI 150
    RYKKPMKVDS ICNLDIFYFP FDQQNCTLTF SSFLYTVDSM LLDMEKEVWE 200
    ITDASRNILQ THGEWELLGL SKATAKLSRG GNLYDQIVFY VAIRRRPSLY 250
    VINLLVPSGF LVAIDALSFY LPVKSGNRVP FKITLLLGYN VFLLMMSDLL 300
    PTSGTPLIGV YFALCLSLMV GSLLETIFIT HLLHVATTQP PPLPRWLHSL 350
    LLHCNSPGRC CPTAPQKENK GPGLTPTHLP GVKEPEVSAG QMPGPAEAEL 400
    TGGSEWTRAQ REHEAQKQHS VELWLQFSHA MDAMLFRLYL LFMASSIITV 450
    ICLWNT 456
    Length:456
    Mass (Da):51,438
    Last modified:July 10, 2007 - v1
    Checksum:i4BFA6561BA309E83
    GO
    Isoform 2 (identifier: A5X5Y0-2) [UniParc]FASTAAdd to Basket

    Also known as: 5-HT3c1

    The sequence of this isoform differs from the canonical sequence as follows:
         79-93: Missing.

    Show »
    Length:441
    Mass (Da):49,596
    Checksum:iF604941E9F3849D6
    GO
    Isoform 3 (identifier: A5X5Y0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT

    Show »
    Length:471
    Mass (Da):52,808
    Checksum:i94A7B8D13492E8F1
    GO
    Isoform 4 (identifier: A5X5Y0-4) [UniParc]FASTAAdd to Basket

    Also known as: 5-HT3c1 long

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
         79-93: Missing.

    Show »
    Length:456
    Mass (Da):50,965
    Checksum:i81FD94F996ED344D
    GO
    Isoform 5 (identifier: A5X5Y0-6) [UniParc]FASTAAdd to Basket

    Also known as: HTR3E_V3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
         79-93: Missing.
         129-129: E → ELCVSRAGQREVPSPGSHRDHSLPLGP

    Show »
    Length:482
    Mass (Da):53,700
    Checksum:iDDE59C2099D78219
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti44 – 441A → T in AAI01183. (PubMed:15489334)Curated
    Sequence conflicti44 – 441A → T in AAI01184. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti71 – 711A → T.1 Publication
    Corresponds to variant rs7627615 [ dbSNP | Ensembl ].
    VAR_037481
    Natural varianti430 – 4301A → T.
    Corresponds to variant rs13324468 [ dbSNP | Ensembl ].
    VAR_037482

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2222MEGSW…GFLLQ → MLAFILSRATPRPALGPLSY REHRVALLHLTHSMSTT in isoform 3, isoform 4 and isoform 5. 5 PublicationsVSP_029803Add
    BLAST
    Alternative sequencei79 – 9315Missing in isoform 2, isoform 4 and isoform 5. 2 PublicationsVSP_029804Add
    BLAST
    Alternative sequencei129 – 1291E → ELCVSRAGQREVPSPGSHRD HSLPLGP in isoform 5. 1 PublicationVSP_045573

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY349352 mRNA. Translation: AAQ93476.1.
    AY349353 mRNA. Translation: AAQ93477.1.
    AY159813 mRNA. Translation: AAO38167.2.
    DQ644022 mRNA. Translation: ABG35128.1.
    EU165354 mRNA. Translation: ABW05298.1.
    AC131235 Genomic DNA. No translation available.
    BC101182 mRNA. Translation: AAI01183.1.
    BC101183 mRNA. Translation: AAI01184.1.
    BC101185 mRNA. Translation: AAI01186.1.
    CCDSiCCDS3251.1. [A5X5Y0-3]
    CCDS58868.1. [A5X5Y0-1]
    CCDS58869.1. [A5X5Y0-2]
    CCDS58870.1. [A5X5Y0-4]
    CCDS58871.1. [A5X5Y0-6]
    RefSeqiNP_001243542.1. NM_001256613.1. [A5X5Y0-1]
    NP_001243543.1. NM_001256614.1. [A5X5Y0-6]
    NP_872395.2. NM_182589.2. [A5X5Y0-3]
    NP_938055.1. NM_198313.2. [A5X5Y0-2]
    NP_938056.1. NM_198314.2. [A5X5Y0-4]
    XP_005247433.1. XM_005247376.1.
    UniGeneiHs.449179.

    Genome annotation databases

    EnsembliENST00000335304; ENSP00000335511; ENSG00000186038. [A5X5Y0-3]
    ENST00000415389; ENSP00000401444; ENSG00000186038. [A5X5Y0-1]
    ENST00000425359; ENSP00000401900; ENSG00000186038. [A5X5Y0-2]
    ENST00000436361; ENSP00000395833; ENSG00000186038. [A5X5Y0-4]
    ENST00000440596; ENSP00000406050; ENSG00000186038. [A5X5Y0-6]
    GeneIDi285242.
    KEGGihsa:285242.
    UCSCiuc003fml.4. human. [A5X5Y0-2]
    uc003fmm.3. human. [A5X5Y0-3]
    uc003fmn.3. human. [A5X5Y0-4]
    uc010hxq.3. human. [A5X5Y0-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY349352 mRNA. Translation: AAQ93476.1 .
    AY349353 mRNA. Translation: AAQ93477.1 .
    AY159813 mRNA. Translation: AAO38167.2 .
    DQ644022 mRNA. Translation: ABG35128.1 .
    EU165354 mRNA. Translation: ABW05298.1 .
    AC131235 Genomic DNA. No translation available.
    BC101182 mRNA. Translation: AAI01183.1 .
    BC101183 mRNA. Translation: AAI01184.1 .
    BC101185 mRNA. Translation: AAI01186.1 .
    CCDSi CCDS3251.1. [A5X5Y0-3 ]
    CCDS58868.1. [A5X5Y0-1 ]
    CCDS58869.1. [A5X5Y0-2 ]
    CCDS58870.1. [A5X5Y0-4 ]
    CCDS58871.1. [A5X5Y0-6 ]
    RefSeqi NP_001243542.1. NM_001256613.1. [A5X5Y0-1 ]
    NP_001243543.1. NM_001256614.1. [A5X5Y0-6 ]
    NP_872395.2. NM_182589.2. [A5X5Y0-3 ]
    NP_938055.1. NM_198313.2. [A5X5Y0-2 ]
    NP_938056.1. NM_198314.2. [A5X5Y0-4 ]
    XP_005247433.1. XM_005247376.1.
    UniGenei Hs.449179.

    3D structure databases

    ProteinModelPortali A5X5Y0.
    SMRi A5X5Y0. Positions 52-324.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000335511.

    Chemistry

    BindingDBi A5X5Y0.
    ChEMBLi CHEMBL2094132.
    DrugBanki DB01049. Ergoloid mesylate.
    GuidetoPHARMACOLOGYi 377.

    Proteomic databases

    PaxDbi A5X5Y0.
    PRIDEi A5X5Y0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000335304 ; ENSP00000335511 ; ENSG00000186038 . [A5X5Y0-3 ]
    ENST00000415389 ; ENSP00000401444 ; ENSG00000186038 . [A5X5Y0-1 ]
    ENST00000425359 ; ENSP00000401900 ; ENSG00000186038 . [A5X5Y0-2 ]
    ENST00000436361 ; ENSP00000395833 ; ENSG00000186038 . [A5X5Y0-4 ]
    ENST00000440596 ; ENSP00000406050 ; ENSG00000186038 . [A5X5Y0-6 ]
    GeneIDi 285242.
    KEGGi hsa:285242.
    UCSCi uc003fml.4. human. [A5X5Y0-2 ]
    uc003fmm.3. human. [A5X5Y0-3 ]
    uc003fmn.3. human. [A5X5Y0-4 ]
    uc010hxq.3. human. [A5X5Y0-1 ]

    Organism-specific databases

    CTDi 285242.
    GeneCardsi GC03P183814.
    HGNCi HGNC:24005. HTR3E.
    HPAi HPA049764.
    MIMi 610123. gene.
    neXtProti NX_A5X5Y0.
    PharmGKBi PA134900226.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG316889.
    HOGENOMi HOG000241519.
    HOVERGENi HBG106638.
    InParanoidi A5X5Y0.
    KOi K04819.
    OMAi ATKNLWL.
    OrthoDBi EOG7XPZ5D.
    PhylomeDBi A5X5Y0.
    TreeFami TF315605.

    Enzyme and pathway databases

    Reactomei REACT_25387. Ligand-gated ion channel transport.

    Miscellaneous databases

    GeneWikii HTR3E.
    GenomeRNAii 285242.
    NextBioi 95380.
    PROi A5X5Y0.
    SOURCEi Search...

    Gene expression databases

    CleanExi HS_HTR3E.
    Genevestigatori A5X5Y0.

    Family and domain databases

    Gene3Di 1.20.120.370. 2 hits.
    2.70.170.10. 1 hit.
    InterProi IPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    [Graphical view ]
    PANTHERi PTHR18945. PTHR18945. 1 hit.
    Pfami PF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 1 hit.
    [Graphical view ]
    PRINTSi PR00252. NRIONCHANNEL.
    SUPFAMi SSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E."
      Niesler B., Frank B., Kapeller J., Rappold G.A.
      Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), TISSUE SPECIFICITY.
    3. "Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E."
      Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M.
      Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), SUBUNIT, SUBCELLULAR LOCATION.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANT THR-71.
    5. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).

    Entry informationi

    Entry namei5HT3E_HUMAN
    AccessioniPrimary (citable) accession number: A5X5Y0
    Secondary accession number(s): A8IKD7
    , E9PGF1, Q495G1, Q495G3, Q6V706, Q6V707, Q7Z6B2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: July 10, 2007
    Last modified: October 1, 2014
    This is version 78 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3