Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A5X5Y0 (5HT3E_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 76. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
5-hydroxytryptamine receptor 3E

Short name=5-HT3-E
Short name=5-HT3E
Alternative name(s):
Serotonin receptor 3E
Gene names
Name:HTR3E
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length456 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

Subunit structure

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex. Ref.3

Subcellular location

Cell membrane; Multi-pass membrane protein. Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A. Ref.3 Ref.4

Tissue specificity

Expressed in adult colon and intestine. Ref.1 Ref.2

Sequence similarities

Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3E sub-subfamily. [View classification]

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A5X5Y0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A5X5Y0-2)

Also known as: 5-HT3c1;

The sequence of this isoform differs from the canonical sequence as follows:
     79-93: Missing.
Isoform 3 (identifier: A5X5Y0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
Isoform 4 (identifier: A5X5Y0-4)

Also known as: 5-HT3c1 long;

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.
Isoform 5 (identifier: A5X5Y0-6)

Also known as: HTR3E_V3;

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.
     129-129: E → ELCVSRAGQREVPSPGSHRDHSLPLGP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2525 Potential
Chain26 – 4564315-hydroxytryptamine receptor 3E
PRO_0000312294

Regions

Topological domain26 – 248223Extracellular Potential
Transmembrane249 – 26921Helical; Name=1; Potential
Topological domain270 – 28213Cytoplasmic Potential
Transmembrane283 – 30321Helical; Name=2; Potential
Topological domain304 – 3074Extracellular Potential
Transmembrane308 – 32821Helical; Name=3; Potential
Topological domain329 – 433105Cytoplasmic Potential
Transmembrane434 – 45421Helical; Name=4; Potential
Topological domain455 – 4562Extracellular Potential

Amino acid modifications

Glycosylation1751N-linked (GlcNAc...) Potential
Disulfide bond162 ↔ 176 By similarity

Natural variations

Alternative sequence1 – 2222MEGSW…GFLLQ → MLAFILSRATPRPALGPLSY REHRVALLHLTHSMSTT in isoform 3, isoform 4 and isoform 5.
VSP_029803
Alternative sequence79 – 9315Missing in isoform 2, isoform 4 and isoform 5.
VSP_029804
Alternative sequence1291E → ELCVSRAGQREVPSPGSHRD HSLPLGP in isoform 5.
VSP_045573
Natural variant711A → T. Ref.4
Corresponds to variant rs7627615 [ dbSNP | Ensembl ].
VAR_037481
Natural variant4301A → T.
Corresponds to variant rs13324468 [ dbSNP | Ensembl ].
VAR_037482

Experimental info

Sequence conflict441A → T in AAI01183. Ref.6
Sequence conflict441A → T in AAI01184. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 10, 2007. Version 1.
Checksum: 4BFA6561BA309E83

FASTA45651,438
        10         20         30         40         50         60 
MEGSWFHRKR FSFYLLLGFL LQGRGVTFTI NCSGFGQHGA DPTALNSVFN RKPFRPVTNI 

        70         80         90        100        110        120 
SVPTQVNISF AMSAILDVNE QLHLLSSFLW LEMVWDNPFI SWNPEECEGI TKMSMAAKNL 

       130        140        150        160        170        180 
WLPDIFIIEL MDVDKTPKGL TAYVSNEGRI RYKKPMKVDS ICNLDIFYFP FDQQNCTLTF 

       190        200        210        220        230        240 
SSFLYTVDSM LLDMEKEVWE ITDASRNILQ THGEWELLGL SKATAKLSRG GNLYDQIVFY 

       250        260        270        280        290        300 
VAIRRRPSLY VINLLVPSGF LVAIDALSFY LPVKSGNRVP FKITLLLGYN VFLLMMSDLL 

       310        320        330        340        350        360 
PTSGTPLIGV YFALCLSLMV GSLLETIFIT HLLHVATTQP PPLPRWLHSL LLHCNSPGRC 

       370        380        390        400        410        420 
CPTAPQKENK GPGLTPTHLP GVKEPEVSAG QMPGPAEAEL TGGSEWTRAQ REHEAQKQHS 

       430        440        450 
VELWLQFSHA MDAMLFRLYL LFMASSIITV ICLWNT 

« Hide

Isoform 2 (5-HT3c1) [UniParc].

Checksum: F604941E9F3849D6
Show »

FASTA44149,596
Isoform 3 [UniParc].

Checksum: 94A7B8D13492E8F1
Show »

FASTA47152,808
Isoform 4 (5-HT3c1 long) [UniParc].

Checksum: 81FD94F996ED344D
Show »

FASTA45650,965
Isoform 5 (HTR3E_V3) [UniParc].

Checksum: DDE59C2099D78219
Show »

FASTA48253,700

References

« Hide 'large scale' references
[1]"Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E."
Niesler B., Frank B., Kapeller J., Rappold G.A.
Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
[2]"A cluster of novel serotonin receptor 3-like genes on human chromosome 3."
Karnovsky A.M., Gotow L.F., McKinley D.D., Piechan J.L., Ruble C.L., Mills C.J., Schellin K.A.B., Slightom J.L., Fitzgerald L.R., Benjamin C.W., Roberds S.L.
Gene 319:137-148(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), TISSUE SPECIFICITY.
[3]"Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E."
Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M.
Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), SUBUNIT, SUBCELLULAR LOCATION.
[4]"Characterisation of 5-HT3C, 5-HT3D and 5-HT3E receptor subunits: evolution, distribution and function."
Holbrook J.D., Gill C.H., Zebda N., Spencer J.P., Leyland R., Rance K.H., Trinh H., Balmer G., Kelly F.M., Yusaf S.P., Courtenay N., Luck J., Rhodes A., Modha S., Moore S.E., Sanger G.J., Gunthorpe M.J.
J. Neurochem. 108:384-396(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, VARIANT THR-71.
[5]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY349352 mRNA. Translation: AAQ93476.1.
AY349353 mRNA. Translation: AAQ93477.1.
AY159813 mRNA. Translation: AAO38167.2.
DQ644022 mRNA. Translation: ABG35128.1.
EU165354 mRNA. Translation: ABW05298.1.
AC131235 Genomic DNA. No translation available.
BC101182 mRNA. Translation: AAI01183.1.
BC101183 mRNA. Translation: AAI01184.1.
BC101185 mRNA. Translation: AAI01186.1.
CCDSCCDS3251.1. [A5X5Y0-3]
CCDS58868.1. [A5X5Y0-1]
CCDS58869.1. [A5X5Y0-2]
CCDS58870.1. [A5X5Y0-4]
CCDS58871.1. [A5X5Y0-6]
RefSeqNP_001243542.1. NM_001256613.1. [A5X5Y0-1]
NP_001243543.1. NM_001256614.1. [A5X5Y0-6]
NP_872395.2. NM_182589.2. [A5X5Y0-3]
NP_938055.1. NM_198313.2. [A5X5Y0-2]
NP_938056.1. NM_198314.2. [A5X5Y0-4]
XP_005247433.1. XM_005247376.1.
UniGeneHs.449179.

3D structure databases

ProteinModelPortalA5X5Y0.
SMRA5X5Y0. Positions 52-324.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000335511.

Chemistry

BindingDBA5X5Y0.
ChEMBLCHEMBL2094132.
GuidetoPHARMACOLOGY377.

Proteomic databases

PaxDbA5X5Y0.
PRIDEA5X5Y0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000335304; ENSP00000335511; ENSG00000186038. [A5X5Y0-3]
ENST00000415389; ENSP00000401444; ENSG00000186038. [A5X5Y0-1]
ENST00000425359; ENSP00000401900; ENSG00000186038. [A5X5Y0-2]
ENST00000436361; ENSP00000395833; ENSG00000186038. [A5X5Y0-4]
ENST00000440596; ENSP00000406050; ENSG00000186038. [A5X5Y0-6]
GeneID285242.
KEGGhsa:285242.
UCSCuc003fml.4. human. [A5X5Y0-2]
uc003fmm.3. human. [A5X5Y0-3]
uc003fmn.3. human. [A5X5Y0-4]
uc010hxq.3. human. [A5X5Y0-1]

Organism-specific databases

CTD285242.
GeneCardsGC03P183814.
HGNCHGNC:24005. HTR3E.
HPAHPA049764.
MIM610123. gene.
neXtProtNX_A5X5Y0.
PharmGKBPA134900226.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG316889.
HOGENOMHOG000241519.
HOVERGENHBG106638.
InParanoidA5X5Y0.
KOK04819.
OMAATKNLWL.
OrthoDBEOG7XPZ5D.
PhylomeDBA5X5Y0.
TreeFamTF315605.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

CleanExHS_HTR3E.
GenevestigatorA5X5Y0.

Family and domain databases

Gene3D1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
[Graphical view]
PANTHERPTHR18945. PTHR18945. 1 hit.
PfamPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
PRINTSPR00252. NRIONCHANNEL.
SUPFAMSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
PROSITEPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiHTR3E.
GenomeRNAi285242.
NextBio95380.
PROA5X5Y0.
SOURCESearch...

Entry information

Entry name5HT3E_HUMAN
AccessionPrimary (citable) accession number: A5X5Y0
Secondary accession number(s): A8IKD7 expand/collapse secondary AC list , E9PGF1, Q495G1, Q495G3, Q6V706, Q6V707, Q7Z6B2
Entry history
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM