Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling protein-like

Gene

RGSL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling protein-like
Gene namesi
Name:RGSL1
Synonyms:RGSL, RGSL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:18636. RGSL1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei960 – 98223HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134870196.

Polymorphism and mutation databases

BioMutaiRGSL1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10761076Regulator of G-protein signaling protein-likePRO_0000349305Add
BLAST

Proteomic databases

EPDiA5PLK6.
PaxDbiA5PLK6.
PRIDEiA5PLK6.

PTM databases

iPTMnetiA5PLK6.
PhosphoSiteiA5PLK6.

Expressioni

Gene expression databases

BgeeiA5PLK6.
ExpressionAtlasiA5PLK6. baseline and differential.

Interactioni

Protein-protein interaction databases

BioGridi131681. 2 interactions.
STRINGi9606.ENSP00000457748.

Structurei

3D structure databases

ProteinModelPortaliA5PLK6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini645 – 764120RGSAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1044 – 10474Poly-Ser

Sequence similaritiesi

Contains 1 RGS domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVN7. Eukaryota.
ENOG4111P2K. LUCA.
GeneTreeiENSGT00660000095605.
HOVERGENiHBG108405.
InParanoidiA5PLK6.
OMAiWFLIFTT.
OrthoDBiEOG72VH57.
PhylomeDBiA5PLK6.
TreeFamiTF336510.

Family and domain databases

InterProiIPR016137. RGS.
[Graphical view]
PfamiPF00615. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 2 hits.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A5PLK6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSAEIIGST NLIILLEDEV FADFFNTFLS LPVFGQTPFY TVENSQWSLW
60 70 80 90 100
PEIPCNLIAK YKGLLTWLEK CRLPFFCKTN LCFHYILCQE FISFIKSPEG
110 120 130 140 150
GEELVDFWIL AENILSIDEM DLEVRDYYLS LLLMLRATHL QEGSRVVTLC
160 170 180 190 200
NMNIKSLLNL SIWHPNQSTT RREILSHMQK VALFKLQSYW LPNFYTHTKM
210 220 230 240 250
TMAKEEACHG LMQEYETRLY SVCYTHIGGL PLNMSIKKCH HFQKRYSSRK
260 270 280 290 300
AKRKMWQLVD PDSWSLEMDL KPDAIGMPLQ ETCPQEKVVI QMPSLKMASS
310 320 330 340 350
KETRISSLEK DMHYAKISSM ENKAKSHLHM EAPFETKVST HLRTVIPIVN
360 370 380 390 400
HSSKMTIQKA IKQSFSLGYI HLALCADACA GNPFRDHLKK LNLKVEIQLL
410 420 430 440 450
DLWQDLQHFL SVLLNNKKNG NAIFRHLLGD RICELYLNEQ IGPCLPLKSQ
460 470 480 490 500
TIQGLKELLP SGDVIPWIPK AQKEICKMLS PWYDEFLDEE DYWFLLFTTQ
510 520 530 540 550
NRFISSRQHK REFIGKEENI LLYKRIQQSL ELSQALADMK EMDYRQWRKI
560 570 580 590 600
ATEDLKQGGS LQVELTSPVF LTDITKMSFE ELCYKNPKMA IQKISDDYKI
610 620 630 640 650
YCEKAPKIDF KMEIIKETKT VSRSNRKMSL LKRTLVRKPS MRPRNLTEVL
660 670 680 690 700
LNTQHLEFFR EFLKERKAKI PLQFLTAVQK ISIETNEKIC KSLIENVIKT
710 720 730 740 750
FFQGQLSPEE MLQCDAPIIK EIASMRHVTT STLLTLQGHV MKSIEEKWFK
760 770 780 790 800
DYQDLFPPHH QEVEVQSEVQ ISSRKPSKIV STYLQESQKK GWMRMISFIR
810 820 830 840 850
SFCKYRRFML NPSKRQEFED YLHQEMQNSK ENFTTAHNTS GRSAPPSTNV
860 870 880 890 900
RSADQENGEI TLVKRRIFGH RIITVNFAIN DLYFFSEMEK FNDLVSSAHM
910 920 930 940 950
LQVNRAYNEN DVILMRSKMN IIQKLFLNSD IPPKLRVNVP EFQKDAILAA
960 970 980 990 1000
ITEGYLDRSV FHGAIMSVFP VVMYFWKRFC FWKATRSYLQ YRGKKFKDRK
1010 1020 1030 1040 1050
SPPKSTDKYP FSSGGDNAIL RFTLLRGIEW LQPQREAISS VQNSSSSKLT
1060 1070
QPRLVVSAMQ LHPVQGQKLS YIKKEK
Note: No experimental confirmation available.
Length:1,076
Mass (Da):125,688
Last modified:July 10, 2007 - v1
Checksum:i7B398FB2DAA2C7E7
GO
Isoform 2 (identifier: A5PLK6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-477: Missing.

Note: No experimental confirmation available.
Show »
Length:599
Mass (Da):70,585
Checksum:iC33828386783ACAF
GO
Isoform 3 (identifier: A5PLK6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-576: Missing.

Show »
Length:500
Mass (Da):58,632
Checksum:iA319D30E28B5DFD8
GO
Isoform 4 (identifier: A5PLK6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-576: Missing.
     979-1076: Missing.

Show »
Length:402
Mass (Da):47,326
Checksum:i0F53417E39786501
GO
Isoform 5 (identifier: A5PLK6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-477: Missing.
     938-949: NVPEFQKDAILA → LFLEGNPLLLTV
     950-1076: Missing.

Note: No experimental confirmation available.
Show »
Length:472
Mass (Da):55,860
Checksum:iF14AA083F5659847
GO
Isoform 6 (identifier: A5PLK6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     100-100: G → GAKMMRWKKADQWLLQKCIGGVRGMWRFYSYLTGSA
     499-504: TQNRFI → VGRTLG
     505-1076: Missing.

Show »
Length:539
Mass (Da):62,597
Checksum:iECA07C75D6FA7035
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti683 – 6831I → V in BC121032 (PubMed:15489334).Curated
Sequence conflicti683 – 6831I → V in BC121033 (PubMed:15489334).Curated
Sequence conflicti823 – 8231H → L in BC121032 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti5 – 51E → D.
Corresponds to variant rs12083859 [ dbSNP | Ensembl ].
VAR_046356
Natural varianti256 – 2561W → C.
Corresponds to variant rs647224 [ dbSNP | Ensembl ].
VAR_046357

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 576576Missing in isoform 3 and isoform 4. 2 PublicationsVSP_035347Add
BLAST
Alternative sequencei1 – 477477Missing in isoform 2 and isoform 5. 1 PublicationVSP_035348Add
BLAST
Alternative sequencei100 – 1001G → GAKMMRWKKADQWLLQKCIG GVRGMWRFYSYLTGSA in isoform 6. 1 PublicationVSP_035349
Alternative sequencei499 – 5046TQNRFI → VGRTLG in isoform 6. 1 PublicationVSP_035350
Alternative sequencei505 – 1076572Missing in isoform 6. 1 PublicationVSP_035351Add
BLAST
Alternative sequencei938 – 94912NVPEF…DAILA → LFLEGNPLLLTV in isoform 5. 1 PublicationVSP_035352Add
BLAST
Alternative sequencei950 – 1076127Missing in isoform 5. 1 PublicationVSP_035353Add
BLAST
Alternative sequencei979 – 107698Missing in isoform 4. 1 PublicationVSP_035354Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF510428 mRNA. Translation: AAP30864.1.
AL136902 mRNA. Translation: CAB66836.1.
AK128152 mRNA. Translation: BAC87300.1.
AL138776 Genomic DNA. No translation available.
AL139344 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91125.1.
BC121032 mRNA. No translation available.
BC121033 mRNA. No translation available.
BC142944 mRNA. Translation: AAI42945.1.
CCDSiCCDS58049.1. [A5PLK6-1]
RefSeqiNP_001131141.1. NM_001137669.1. [A5PLK6-1]
UniGeneiHs.121200.

Genome annotation databases

EnsembliENST00000294854; ENSP00000457748; ENSG00000121446. [A5PLK6-1]
GeneIDi353299.
KEGGihsa:353299.
UCSCiuc009wxw.5. human. [A5PLK6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF510428 mRNA. Translation: AAP30864.1.
AL136902 mRNA. Translation: CAB66836.1.
AK128152 mRNA. Translation: BAC87300.1.
AL138776 Genomic DNA. No translation available.
AL139344 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91125.1.
BC121032 mRNA. No translation available.
BC121033 mRNA. No translation available.
BC142944 mRNA. Translation: AAI42945.1.
CCDSiCCDS58049.1. [A5PLK6-1]
RefSeqiNP_001131141.1. NM_001137669.1. [A5PLK6-1]
UniGeneiHs.121200.

3D structure databases

ProteinModelPortaliA5PLK6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131681. 2 interactions.
STRINGi9606.ENSP00000457748.

PTM databases

iPTMnetiA5PLK6.
PhosphoSiteiA5PLK6.

Polymorphism and mutation databases

BioMutaiRGSL1.

Proteomic databases

EPDiA5PLK6.
PaxDbiA5PLK6.
PRIDEiA5PLK6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294854; ENSP00000457748; ENSG00000121446. [A5PLK6-1]
GeneIDi353299.
KEGGihsa:353299.
UCSCiuc009wxw.5. human. [A5PLK6-1]

Organism-specific databases

CTDi353299.
GeneCardsiRGSL1.
HGNCiHGNC:18636. RGSL1.
MIMi611012. gene.
611013. gene.
neXtProtiNX_A5PLK6.
PharmGKBiPA134870196.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVN7. Eukaryota.
ENOG4111P2K. LUCA.
GeneTreeiENSGT00660000095605.
HOVERGENiHBG108405.
InParanoidiA5PLK6.
OMAiWFLIFTT.
OrthoDBiEOG72VH57.
PhylomeDBiA5PLK6.
TreeFamiTF336510.

Miscellaneous databases

GenomeRNAii353299.
NextBioi99768.
PROiA5PLK6.
SOURCEiSearch...

Gene expression databases

BgeeiA5PLK6.
ExpressionAtlasiA5PLK6. baseline and differential.

Family and domain databases

InterProiIPR016137. RGS.
[Graphical view]
PfamiPF00615. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 2 hits.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of 17 additional transcripts within the hereditary prostate cancer locus (HPC1) at 1q25."
    Silva A.P.M., Caballero O., de Souza S.J., Simpson A.J.G., Camargo A.A.
    Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Testis.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).

Entry informationi

Entry nameiRGSL_HUMAN
AccessioniPrimary (citable) accession number: A5PLK6
Secondary accession number(s): A2A2Z0
, A6PVM2, A6PVM3, Q0VAJ4, Q0VAJ5, Q6ZRL0, Q86UV0, Q9H084
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 10, 2007
Last modified: March 16, 2016
This is version 65 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.