Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-type lectin domain family 18 member A

Gene

CLEC18A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds polysaccharides in a Ca2+-independent manner with a preferentially binding to fucoidan, beta-glucans and galactans (PubMed:26170455).1 Publication

GO - Molecular functioni

  • polysaccharide binding Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Lectin

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 18 member A
Alternative name(s):
Mannose receptor-like protein 2
Gene namesi
Name:CLEC18A
Synonyms:MRLP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:30388. CLEC18A.

Subcellular locationi

GO - Cellular componenti

  • endoplasmic reticulum Source: UniProtKB
  • endosome Source: UniProtKB
  • extracellular space Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Endosome, Golgi apparatus, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi421D → N: Has a mild effect on polysaccharides binding. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000157322.
PharmGKBiPA164717976.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 26Sequence analysisAdd BLAST26
ChainiPRO_000032431627 – 446C-type lectin domain family 18 member AAdd BLAST420

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi144N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi236 ↔ 249By similarity
Disulfide bondi251 ↔ 260By similarity
Disulfide bondi327 ↔ 432By similarity
Disulfide bondi408 ↔ 424By similarity

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiA5D8T8.
PRIDEiA5D8T8.

PTM databases

iPTMnetiA5D8T8.
PhosphoSitePlusiA5D8T8.

Expressioni

Tissue specificityi

Dectected in all cell lines tested and in peripheral blood cells.1 Publication

Gene expression databases

BgeeiENSG00000157322.
ExpressionAtlasiA5D8T8. baseline and differential.
GenevisibleiA5D8T8. HS.

Organism-specific databases

HPAiHPA048976.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ADAMTSL4Q6UY14-33EBI-10173491,EBI-10173507
KRT40Q6A1623EBI-10173491,EBI-10171697
NOTCH2NLQ7Z3S93EBI-10173491,EBI-945833

Protein-protein interaction databases

BioGridi131512. 11 interactors.
IntActiA5D8T8. 6 interactors.

Structurei

3D structure databases

ProteinModelPortaliA5D8T8.
SMRiA5D8T8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 182SCPAdd BLAST131
Domaini228 – 261EGF-likePROSITE-ProRule annotationAdd BLAST34
Domaini306 – 433C-type lectinPROSITE-ProRule annotationAdd BLAST128

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation
Contains 1 EGF-like domain.PROSITE-ProRule annotation
Contains 1 SCP domain.Curated

Keywords - Domaini

EGF-like domain, Signal

Phylogenomic databases

eggNOGiKOG3017. Eukaryota.
KOG4297. Eukaryota.
COG2340. LUCA.
GeneTreeiENSGT00760000119004.
HOGENOMiHOG000111780.
InParanoidiA5D8T8.
PhylomeDBiA5D8T8.
TreeFamiTF350472.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
3.40.33.10. 1 hit.
InterProiIPR001283. Allrgn_V5/Tpx1.
IPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR018378. C-type_lectin_CS.
IPR014044. CAP_domain.
IPR016187. CTDL_fold.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
[Graphical view]
PANTHERiPTHR10334. PTHR10334. 1 hit.
PfamiPF00188. CAP. 1 hit.
PF00059. Lectin_C. 1 hit.
[Graphical view]
PRINTSiPR00837. V5TPXLIKE.
SMARTiSM00034. CLECT. 1 hit.
SM00181. EGF. 2 hits.
SM00198. SCP. 1 hit.
[Graphical view]
SUPFAMiSSF55797. SSF55797. 1 hit.
SSF56436. SSF56436. 1 hit.
PROSITEiPS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A5D8T8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLHPETSPGR GHLLAVLLAL LGTAWAEVWP PQLQEQAPMA GALNRKESFL
60 70 80 90 100
LLSLHNRLRS WVQPPAADMR RLDWSDSLAQ LAQARAALCG TPTPSLASGL
110 120 130 140 150
WRTLQVGWNM QLLPAGLVSF VEVVSLWFAE GQRYSHAAGE CARNATCTHY
160 170 180 190 200
TQLVWATSSQ LGCGRHLCSA GQAAIEAFVC AYSPRGNWEV NGKTIVPYKK
210 220 230 240 250
GAWCSLCTAS VSGCFKAWDH AGGLCEVPRN PCRMSCQNHG RLNISTCHCH
260 270 280 290 300
CPPGYTGRYC QVRCSLQCVH GRFREEECSC VCDIGYGGAQ CATKVHFPFH
310 320 330 340 350
TCDLRIDGDC FMVSSEADTY YRARMKCQRK GGVLAQIKSQ KVQDILAFYL
360 370 380 390 400
GRLETTNEVI DSDFETRNFW IGLTYKTAKD SFRWATGEHQ AFTSFAFGQP
410 420 430 440
DNHGFGNCVE LQASAAFNWN DQRCKTRNRY ICQFAQEHIS RWGPGS
Length:446
Mass (Da):49,602
Last modified:November 25, 2008 - v3
Checksum:iC33BD9480D47DB9B
GO
Isoform 2 (identifier: A5D8T8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-340: Missing.
     341-371: KVQDILAFYLGRLETTNEVIDSDFETRNFWI → MGAASAGKRGQKGSWQQTPGSEWANLDYPGP

Show »
Length:106
Mass (Da):11,762
Checksum:iBCF4991E23A9F0B0
GO

Sequence cautioni

The sequence AAH08616 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti273F → L in AAH78143 (PubMed:15489334).Curated1
Sequence conflicti401 – 402DN → AT in AAH08616 (PubMed:15489334).Curated2
Sequence conflicti421D → N in AAH78143 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059449118V → A in allele CLEC18A-1. 4 PublicationsCorresponds to variant rs2549097dbSNPEnsembl.1
Natural variantiVAR_074610151T → M in allele CLEC18A-1. 3 PublicationsCorresponds to variant rs75776403dbSNPEnsembl.1
Natural variantiVAR_074611339S → R in allele CLEC18A-1; abolishes binding to polysaccharides. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0322041 – 340Missing in isoform 2. 1 PublicationAdd BLAST340
Alternative sequenceiVSP_032205341 – 371KVQDI…RNFWI → MGAASAGKRGQKGSWQQTPG SEWANLDYPGP in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521893 mRNA. Translation: AAP80866.1.
AK289884 mRNA. Translation: BAF82573.1.
AC026468 Genomic DNA. No translation available.
BC008616 mRNA. Translation: AAH08616.1. Different initiation.
BC078143 mRNA. Translation: AAH78143.1.
BC141808 mRNA. Translation: AAI41809.1.
CCDSiCCDS10886.1. [A5D8T8-1]
RefSeqiNP_001129686.1. NM_001136214.2. [A5D8T8-1]
NP_001258126.1. NM_001271197.1. [A5D8T8-1]
NP_872425.2. NM_182619.3. [A5D8T8-1]
XP_005255991.1. XM_005255934.1. [A5D8T8-1]
UniGeneiHs.592064.

Genome annotation databases

EnsembliENST00000288040; ENSP00000288040; ENSG00000157322. [A5D8T8-1]
ENST00000393701; ENSP00000377304; ENSG00000157322. [A5D8T8-1]
ENST00000568461; ENSP00000454685; ENSG00000157322. [A5D8T8-1]
ENST00000615430; ENSP00000484176; ENSG00000157322. [A5D8T8-1]
GeneIDi348174.
KEGGihsa:348174.
UCSCiuc002exz.5. human. [A5D8T8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521893 mRNA. Translation: AAP80866.1.
AK289884 mRNA. Translation: BAF82573.1.
AC026468 Genomic DNA. No translation available.
BC008616 mRNA. Translation: AAH08616.1. Different initiation.
BC078143 mRNA. Translation: AAH78143.1.
BC141808 mRNA. Translation: AAI41809.1.
CCDSiCCDS10886.1. [A5D8T8-1]
RefSeqiNP_001129686.1. NM_001136214.2. [A5D8T8-1]
NP_001258126.1. NM_001271197.1. [A5D8T8-1]
NP_872425.2. NM_182619.3. [A5D8T8-1]
XP_005255991.1. XM_005255934.1. [A5D8T8-1]
UniGeneiHs.592064.

3D structure databases

ProteinModelPortaliA5D8T8.
SMRiA5D8T8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131512. 11 interactors.
IntActiA5D8T8. 6 interactors.

PTM databases

iPTMnetiA5D8T8.
PhosphoSitePlusiA5D8T8.

Proteomic databases

PaxDbiA5D8T8.
PRIDEiA5D8T8.

Protocols and materials databases

DNASUi348174.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288040; ENSP00000288040; ENSG00000157322. [A5D8T8-1]
ENST00000393701; ENSP00000377304; ENSG00000157322. [A5D8T8-1]
ENST00000568461; ENSP00000454685; ENSG00000157322. [A5D8T8-1]
ENST00000615430; ENSP00000484176; ENSG00000157322. [A5D8T8-1]
GeneIDi348174.
KEGGihsa:348174.
UCSCiuc002exz.5. human. [A5D8T8-1]

Organism-specific databases

CTDi348174.
GeneCardsiCLEC18A.
HGNCiHGNC:30388. CLEC18A.
HPAiHPA048976.
MIMi616571. gene.
neXtProtiNX_A5D8T8.
OpenTargetsiENSG00000157322.
PharmGKBiPA164717976.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3017. Eukaryota.
KOG4297. Eukaryota.
COG2340. LUCA.
GeneTreeiENSGT00760000119004.
HOGENOMiHOG000111780.
InParanoidiA5D8T8.
PhylomeDBiA5D8T8.
TreeFamiTF350472.

Miscellaneous databases

ChiTaRSiCLEC18A. human.
GenomeRNAii348174.
PROiA5D8T8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000157322.
ExpressionAtlasiA5D8T8. baseline and differential.
GenevisibleiA5D8T8. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
3.40.33.10. 1 hit.
InterProiIPR001283. Allrgn_V5/Tpx1.
IPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR018378. C-type_lectin_CS.
IPR014044. CAP_domain.
IPR016187. CTDL_fold.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
[Graphical view]
PANTHERiPTHR10334. PTHR10334. 1 hit.
PfamiPF00188. CAP. 1 hit.
PF00059. Lectin_C. 1 hit.
[Graphical view]
PRINTSiPR00837. V5TPXLIKE.
SMARTiSM00034. CLECT. 1 hit.
SM00181. EGF. 2 hits.
SM00198. SCP. 1 hit.
[Graphical view]
SUPFAMiSSF55797. SSF55797. 1 hit.
SSF56436. SSF56436. 1 hit.
PROSITEiPS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCL18A_HUMAN
AccessioniPrimary (citable) accession number: A5D8T8
Secondary accession number(s): A8K1G9
, Q6DCB3, Q7Z5K9, Q96HH2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 89 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.