false2007-05-292024-03-2775A4YQD4_BRASOLegumes symbioses: absence of nod genes in photosynthetic bradyrhizobia.Giraud E.Moulin L.Vallenet D.Barbe V.Cytryn E.Avarre J.C.Jaubert M.Simon D.Cartieaux F.Prin Y.Bena G.Hannibal L.Fardoux J.Kojadinovic M.Vuillet L.Lajus A.Cruveiller S.Rouy Z.Mangenot S.Segurens B.Dossat C.Franck W.L.Chang W.S.Saunders E.Bruce D.Richardson P.Normand P.Dreyfus B.Pignol D.Stacey G.Emerich D.Vermeglio A.Medigue C.Sadowsky M.doi:10.1126/science.11395482007Science3161307-1312NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]ORS 278BacteriaRuBisCO_smallRibulose bisphosphate carboxylase, small subunitRuBisCO_S_bactRuBisCO_ssuRuBisCO_ssu_domRuBisCO_ssu_sfRIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1, CHLOROPLASTICRuBisCO_smallRuBisCO_smallRuBisCO, small subunitRibulose bisphosphate carboxylase small subunitRuBisCO small subunitcbbSBRADO2275RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site. Although the small subunit is not catalytic it is essential for maximal activity.Heterohexadecamer of 8 large and 8 small subunits.The basic functional RuBisCO is composed of a large chain homodimer in a 'head-to-tail' conformation. In form I RuBisCO this homodimer is arranged in a barrel-like tetramer with the small subunits forming a tetrameric 'cap' on each end of the 'barrel'.Belongs to the RuBisCO small chain family.Ribulose bisphosphate carboxylase small subunit131102007-05-291131549d41493e94b66597ad26b4e275e30d51MSEAVAYKSAERRGETFSYLPPMTQDRLRRNIAYLIAQNWNPAIEHTEPEKSMSSFWYLWKLPMFGERSIERILGELEACHRTNPGHHVRLIGYDNYSQSQGTAFIVYRAGGR