Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Xin actin-binding repeat-containing protein 2

Gene

XIRP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protects actin filaments from depolymerization.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Xin actin-binding repeat-containing protein 2
Alternative name(s):
Beta-xin
Cardiomyopathy-associated protein 3
Xeplin
Gene namesi
Name:XIRP2
Synonyms:CMYA3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:14303. XIRP2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162409337.

Polymorphism and mutation databases

BioMutaiXIRP2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 33743374Xin actin-binding repeat-containing protein 2PRO_0000316987Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei621 – 6211PhosphoserineBy similarity
Modified residuei868 – 8681PhosphoserineBy similarity
Modified residuei1265 – 12651PhosphoserineBy similarity
Modified residuei1629 – 16291PhosphoserineBy similarity
Modified residuei1989 – 19891PhosphothreonineBy similarity
Modified residuei1994 – 19941PhosphoserineBy similarity
Modified residuei2222 – 22221PhosphoserineBy similarity
Modified residuei2276 – 22761PhosphoserineBy similarity
Modified residuei2318 – 23181PhosphoserineBy similarity
Modified residuei3059 – 30591PhosphoserineBy similarity
Modified residuei3297 – 32971PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiA4UGR9.
PaxDbiA4UGR9.
PeptideAtlasiA4UGR9.
PRIDEiA4UGR9.

PTM databases

iPTMnetiA4UGR9.
PhosphoSiteiA4UGR9.

Expressioni

Gene expression databases

BgeeiA4UGR9.
ExpressionAtlasiA4UGR9. baseline and differential.
GenevisibleiA4UGR9. HS.

Organism-specific databases

HPAiHPA034813.

Interactioni

Subunit structurei

Interacts with ACTN2 (By similarity). Interacts with F-actin.By similarity1 Publication

Protein-protein interaction databases

BioGridi126192. 6 interactions.
IntActiA4UGR9. 3 interactions.
STRINGi9606.ENSP00000295237.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4F14X-ray1.20B2245-2257[»]
ProteinModelPortaliA4UGR9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati362 – 37716Xin 1Add
BLAST
Repeati397 – 41216Xin 2Add
BLAST
Repeati437 – 45216Xin 3Add
BLAST
Repeati474 – 48916Xin 4Add
BLAST
Repeati512 – 52716Xin 5Add
BLAST
Repeati552 – 56716Xin 6Add
BLAST
Repeati590 – 60516Xin 7Add
BLAST
Repeati628 – 64316Xin 8Add
BLAST
Repeati661 – 67616Xin 9Add
BLAST
Repeati695 – 71016Xin 10Add
BLAST
Repeati732 – 74716Xin 11Add
BLAST
Repeati768 – 78316Xin 12Add
BLAST
Repeati799 – 81416Xin 13Add
BLAST
Repeati837 – 85216Xin 14Add
BLAST
Repeati875 – 89016Xin 15Add
BLAST
Repeati914 – 92916Xin 16Add
BLAST
Repeati947 – 96216Xin 17Add
BLAST
Repeati985 – 100016Xin 18Add
BLAST
Repeati1020 – 103516Xin 19Add
BLAST
Repeati1059 – 107416Xin 20Add
BLAST
Repeati1095 – 111016Xin 21Add
BLAST
Repeati1132 – 114716Xin 22Add
BLAST
Repeati1170 – 118516Xin 23Add
BLAST
Repeati1207 – 122216Xin 24Add
BLAST
Repeati1241 – 125616Xin 25Add
BLAST
Repeati1272 – 128716Xin 26Add
BLAST
Repeati1310 – 132516Xin 27Add
BLAST
Repeati1345 – 136016Xin 28Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1736 – 176328Sequence analysisAdd
BLAST
Coiled coili2369 – 239426Sequence analysisAdd
BLAST
Coiled coili2768 – 279225Sequence analysisAdd
BLAST
Coiled coili2823 – 284927Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi278 – 2825Poly-Pro
Compositional biasi1036 – 10416Poly-Ser
Compositional biasi2113 – 220189Pro-richAdd
BLAST

Domaini

Xin repeats bind F-actin.

Sequence similaritiesi

Belongs to the Xin family.PROSITE-ProRule annotation
Contains 28 Xin repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IF8Z. Eukaryota.
ENOG410ZM11. LUCA.
GeneTreeiENSGT00530000063779.
HOVERGENiHBG108682.
InParanoidiA4UGR9.
OMAiRYMFETQ.
OrthoDBiEOG7M0NQJ.
PhylomeDBiA4UGR9.

Family and domain databases

InterProiIPR012510. Actin-binding_Xin_repeat.
IPR030072. XIRP1/XIRP2.
IPR030107. XIRP2.
[Graphical view]
PANTHERiPTHR22591. PTHR22591. 1 hit.
PTHR22591:SF1. PTHR22591:SF1. 1 hit.
PfamiPF08043. Xin. 19 hits.
[Graphical view]
PROSITEiPS51389. XIN. 28 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A4UGR9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPESGHSRI FEATAGPNKP ESGFAEDSAA RGEGVSDLHE VVSLKERMAR
60 70 80 90 100
YQAAVSRGDC RSFSANMMEE SEMCAVPGGL AKVKKQFEDE ITSSRNTFAQ
110 120 130 140 150
YQYQHQNRSE QEAIHSSQVG TSRSSQEMAR NEQEGSKVQK IDVHGTEMVS
160 170 180 190 200
HLEKHTEEVN QASQFHQYVQ ETVIDTPEDE EIPKVSTKLL KEQFEKSAQE
210 220 230 240 250
KILYSDKEMT TPAKQIKTES EYEETFKPSS VVSTSSTSCV STSQRKETST
260 270 280 290 300
TRYSDHSVTS STLAQINATS SGMTEEFPPP PPDVLQTSVD VTAFSQSPEL
310 320 330 340 350
PSPPRRLPVP KDVYSKQRNL YELNRLYKHI HPELRKNLEK DYISEVSEIV
360 370 380 390 400
SSQMNSGSSV SADVQQARYV FENTNDSSQK DLNSEREYLE WDEILKGEVQ
410 420 430 440 450
SIRWIFENQP LDSINNGSPD EGDISRGIAD QEIIAGGDVK YTTWMFETQP
460 470 480 490 500
IDTLGAYSSD TVENAEKIPE LARGDVCTAR WMFETRPLDS MNKMHQSQEE
510 520 530 540 550
SAVTISKDIT GGDVKTVRYM FETQHLDQLG QLHSVDEVHL LQLRSELKEI
560 570 580 590 600
KGNVKRSIKC FETQPLYVIR DGSGQMLEIK TVHREDVEKG DVRTARWMFE
610 620 630 640 650
TQPLDTINKD ITEIKVVRGI SMEENVKGGV SKAKWLFETQ PLEKIKESEE
660 670 680 690 700
VIIEKEKIIG TDVSRKCWMF ETQPLDILKE VPDADSLQRE EIIGGDVQTT
710 720 730 740 750
KHLFETLPIE ALKDSPDIGK LQKITASEEE KGDVRHQKWI FETQPLEDIR
760 770 780 790 800
KDKKEYTRTV KLEEVDRGDV KNYTHIFESN NLIKFDASHK IEVEGVTRGA
810 820 830 840 850
VELNKSLFET TPLYAIQDPL GKYHQVKTVQ QEEIVRGDVR SCRWLFETRP
860 870 880 890 900
IDQFDESIHK FQIIRGISAQ EIQTGNVKSA KWLFETQPLD SIKYFSDVEE
910 920 930 940 950
TESKTEQTRD IVKGDVKTCK WLFETQPMES LYEKVSLMTS SEEIHKGDVK
960 970 980 990 1000
TCTWLFETQP LDTIKDDSET AVKLQTVKQE EIQGGDVRTA CFLFETENLD
1010 1020 1030 1040 1050
SIQGEEVKEI KPVEMDIQAG DVSSMRYKFE NQSLDSISSS SEEVLKKIKT
1060 1070 1080 1090 1100
LKTEDIQKGN VLNCRWLFEN QPIDKIKESQ EGDECVKTVT DIQGGDVRKG
1110 1120 1130 1140 1150
CFIFETFSLD EIKEESDYIS TKKTITEEVI QGDVKSYRML FETQPLYAIQ
1160 1170 1180 1190 1200
DREGSYHEVT TVKKEEVIHG DVRGTRWLFE TKPLDSINKS ETVYVIKSVT
1210 1220 1230 1240 1250
QEDIQKGDVS SVRYRFETQP LDQISEESHN IMPSIDHIQG GNVKTSRQFF
1260 1270 1280 1290 1300
ESENFDKNNY IRTVSVNEIQ KGNVKTSTWL FETHTMDELR GEGLEYENIK
1310 1320 1330 1340 1350
TVTQEDVQKG DVKQAVWLFE NRTFDSIMEA HKGITKMTKE EIPPSDVKTT
1360 1370 1380 1390 1400
TWLFETTPLH EFNETRVEKI EIIGKSIKET LEDLYSQKVI QAPGIIIEAD
1410 1420 1430 1440 1450
EIGDVRMAKY KLMNQASPEI QKEEIIRADL RNIMVNLLSK RDCTEREILI
1460 1470 1480 1490 1500
SEEEKGNVNL TKTQLLNRST EFHAEKEEIV KGDVQQAIKN LFSEERSVKK
1510 1520 1530 1540 1550
GILIQEDEKG DINMTIYCLL HENDGDTIER EEVIGGDVKR TIHNLLSSTS
1560 1570 1580 1590 1600
NNKISERAKI DASERGNVQF FTTCIEAGAL DYLKQLHTES NETLTAKKQE
1610 1620 1630 1640 1650
GEKEIIGGDV EGTKLLLKKR QSLVERTVSE TDIIPGDVHN TVKVFMTEPQ
1660 1670 1680 1690 1700
STFGKIPKEE IIKGDLTSTL NSLSQAVNQK TVTKTEEIIK GNMLATLKSL
1710 1720 1730 1740 1750
KESSHRWKES KQPDAIPGDI EKAIECLEKA TNTKTEILKK ELLKDDLETS
1760 1770 1780 1790 1800
LRSLKEAQRS FKEVHKEGVI KKDAKAVMAG SSGEQKTDIH QVAVQRNKNS
1810 1820 1830 1840 1850
LLQPKPGPFE PAAKWQGGAD TLSQTMGKSC HGNLVEERTE VNLPKAPKGT
1860 1870 1880 1890 1900
VKIVIDREQN NDALEKSLRR LSNSHHKSNV LESGDKTGVW TDTTGEQHLR
1910 1920 1930 1940 1950
DEYMSRQLTS TVSVKNNLTT KESDRAVREL KKDDVFNSIQ SAGKTVGKQQ
1960 1970 1980 1990 2000
TYELRNDHQK MEGFHIKSPK KTKNIKILTD TQSSKPSPTQ HPVSMPVGGT
2010 2020 2030 2040 2050
YDLSGDFQKQ TLLKQETKYS NKDIKKKNIN LQPMWQLLPV EQDTSNVTEM
2060 2070 2080 2090 2100
KVSEKSHNTF KATNKKRETD VHLKSQDFLM KTNTSTGLKM AMERSLNPIN
2110 2120 2130 2140 2150
FNPENNVKES ECPLPPPSPP PPPPSNASSE IEFPLPPPPP LMMFPEKNGF
2160 2170 2180 2190 2200
LPSLSTEKIK AEFESFPGLP LPPPPVDEKS ERESSSMFLP PPPPPTPSQK
2210 2220 2230 2240 2250
PAHLLSSSAP EKHSGDFMQQ YSQKEASNSQ NSQAKIITGK TGVLPPPTLP
2260 2270 2280 2290 2300
KPKLPKHIKD NKNDFSPKVE LATSLSDMEC KITTSKDQKK VMVMTSSEHT
2310 2320 2330 2340 2350
ETKQNVISKS LDERKQLSID SANCLSHTVP GTSAPRKKQI APLIKSHSFP
2360 2370 2380 2390 2400
ESSGQQNPKP YMRKFKTPLM IAEEKYRQQK EEIEKQKQES SYYNIVKTQS
2410 2420 2430 2440 2450
QNQHITEVEK EMPLQKTNEE VSLSGIDSEC TVVQPSPGSQ SNARILGVCS
2460 2470 2480 2490 2500
DNQLSTTSPE TVAAKRLHHV LAASEDKDKM KKEVLQSSRD IMQSKSACEI
2510 2520 2530 2540 2550
KQSHQECSTQ QTQQKKYLEQ LHLPQSKPIS PNFKVKTIKL PTLDHTLNET
2560 2570 2580 2590 2600
DHSYESHKQQ SEIDVQTFTK KQYLKTKKTE ASTECSHKQS LAERHYQLPK
2610 2620 2630 2640 2650
KEKRVTVQLP TESIQKNQED KLKMVPRKQR EFSGSDRGKL PGSEEKNQGP
2660 2670 2680 2690 2700
SMIGRKEERL ITERKHEHLK NKSAPKVVKQ KVIDAHLDSQ TQNFQQTQIQ
2710 2720 2730 2740 2750
TAESKAEHKK LPQPYNSLQE EKCLEVKGIQ EKQVFSNTKD SKQEITQNKS
2760 2770 2780 2790 2800
FFSSVKESQR DDGKGALNIV EFLRKREELQ QILSRVKQFE AEPNKSGLKT
2810 2820 2830 2840 2850
FQTLLNTIPG WLISEDKREY AVHIAMENNL EKVKEEITHI KTQAEDMLVS
2860 2870 2880 2890 2900
YENIIQTAMM SSKTGKPGNK PTSLDETSSK VSNVHVSNNK NSEQKENKIA
2910 2920 2930 2940 2950
KEKTVQHQVA AHHEATVRSH VKTHQEIKLD DSNIPPPSLK TRPPSPTFIT
2960 2970 2980 2990 3000
IESTARRTEN PTKNELSQSP KKDSYVEPPP RRPMSQKSEI HRANTSPSPP
3010 3020 3030 3040 3050
RSRSEQLVRL KDTTAKLSKG AIPCPAATPV PIVEKRSEII MSPATLRRQI
3060 3070 3080 3090 3100
KIETRGRDSP PTITIPVNIN HAASGSFRES VDAQEEIRKV EKRATYVHKD
3110 3120 3130 3140 3150
GLNSTDHMVP DTESYDAVEI IRKVAVPPRL SEHTQRYEAA NRTVQMAENF
3160 3170 3180 3190 3200
VNDPENEINR WFREFEHGPV SEAKSNRRVY AKGETNHNIQ QESRTFCKEE
3210 3220 3230 3240 3250
FGLTSLGNTS FTDFSCKHPR ELREKIPVKQ PRICSETRSL SEHFSGMDAF
3260 3270 3280 3290 3300
ESQIVESKMK TSSSHSSEAG KSGCDFKHAP PTYEDVIAGH ILDISDSPKE
3310 3320 3330 3340 3350
VRKNFQKTWQ ESGRVFKGLG YATADASATE MRTTFQEESA FISEAAAPRQ
3360 3370
GNMYTLSKDS LSNGVPSGRQ AEFS
Length:3,374
Mass (Da):382,300
Last modified:February 5, 2008 - v2
Checksum:iF02A01BD2D621F45
GO
Isoform 2 (identifier: A4UGR9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:3,327
Mass (Da):377,347
Checksum:iDAC9F3BDE6D3EDE9
GO
Isoform 3 (identifier: A4UGR9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3344-3345: EA → GK
     3346-3374: Missing.

Show »
Length:3,345
Mass (Da):379,233
Checksum:iBA1BAC0E92843A1E
GO
Isoform 4 (identifier: A4UGR9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFPMQKGSLN...KGKETSFDKM
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:938
Mass (Da):106,597
Checksum:i07F5488631088491
GO
Isoform 5 (identifier: A4UGR9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:763
Mass (Da):86,782
Checksum:i9C40EB72B01F0750
GO
Isoform 6 (identifier: A4UGR9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFPMQKGSLN...KGKETSFDKM
     13-13: A → AVFSTDQAQILRLHLHPKLTKTPKNSLKSSTYIS
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:971
Mass (Da):110,333
Checksum:iD7D81097B20E3582
GO
Isoform 7 (identifier: A4UGR9-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:716
Mass (Da):81,830
Checksum:i88B0CF8F625388C8
GO
Isoform 8 (identifier: A4UGR9-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFPMQKGSLN...KGKETSFDKM

Note: No experimental confirmation available.
Show »
Length:3,549
Mass (Da):402,115
Checksum:i91C17001D04DCDEC
GO

Sequence cautioni

The sequence AAH18673.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAY24138.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAD38624.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence CAD89958.1 differs from that shown.Contaminating sequence.Curated
The sequence CAD91141.2 differs from that shown.Contaminating sequence.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti112 – 1121E → G in AAH18673 (PubMed:15489334).Curated
Sequence conflicti926 – 9261Q → L in CAF25193 (PubMed:15454575).Curated
Sequence conflicti926 – 9261Q → L in CAD38624 (PubMed:17974005).Curated
Sequence conflicti1144 – 11441Q → R in CAF25193 (PubMed:15454575).Curated
Sequence conflicti1144 – 11441Q → R in CAD38624 (PubMed:17974005).Curated
Sequence conflicti2318 – 23181S → P in CAD91137 (PubMed:17974005).Curated
Sequence conflicti2522 – 25221H → P in CAD91146 (PubMed:17974005).Curated
Sequence conflicti2661 – 26611I → M in CAD91139 (PubMed:17974005).Curated
Sequence conflicti2665 – 26651K → N in CAD89958 (PubMed:17974005).Curated
Sequence conflicti2713 – 27131Q → R in CAD89919 (PubMed:17974005).Curated
Sequence conflicti2967 – 29671S → A in CAD91141 (PubMed:17974005).Curated
Sequence conflicti2996 – 29961S → P in CAD89919 (PubMed:17974005).Curated
Sequence conflicti3013 – 30131T → A in CAD91154 (PubMed:17974005).Curated
Sequence conflicti3079 – 30791E → G in CAD91137 (PubMed:17974005).Curated
Sequence conflicti3121 – 31211I → T in CAD89958 (PubMed:17974005).Curated
Sequence conflicti3166 – 31661E → G in CAD91141 (PubMed:17974005).Curated
Sequence conflicti3259 – 32591M → V in CAD91139 (PubMed:17974005).Curated
Sequence conflicti3264 – 32641S → L in CAD91141 (PubMed:17974005).Curated
Sequence conflicti3329 – 33291T → A in CAD91146 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti450 – 4501P → A.
Corresponds to variant rs16853305 [ dbSNP | Ensembl ].
VAR_038449
Natural varianti457 – 4571Y → H.
Corresponds to variant rs16853306 [ dbSNP | Ensembl ].
VAR_038450
Natural varianti1397 – 13971I → T.
Corresponds to variant rs7588159 [ dbSNP | Ensembl ].
VAR_038451
Natural varianti1488 – 14881I → T.
Corresponds to variant rs7591107 [ dbSNP | Ensembl ].
VAR_038452
Natural varianti1626 – 16261R → H.
Corresponds to variant rs16853309 [ dbSNP | Ensembl ].
VAR_038453
Natural varianti1833 – 18331N → S.
Corresponds to variant rs7607246 [ dbSNP | Ensembl ].
VAR_038454
Natural varianti2423 – 24231L → R.
Corresponds to variant rs16853326 [ dbSNP | Ensembl ].
VAR_038455
Natural varianti2553 – 25531S → N.
Corresponds to variant rs16853328 [ dbSNP | Ensembl ].
VAR_038456
Natural varianti2595 – 25951H → Y.
Corresponds to variant rs16853329 [ dbSNP | Ensembl ].
VAR_038457
Natural varianti2607 – 26071V → I.
Corresponds to variant rs16853330 [ dbSNP | Ensembl ].
VAR_038458
Natural varianti2728 – 27281G → D.
Corresponds to variant rs3749002 [ dbSNP | Ensembl ].
VAR_038459
Natural varianti2910 – 29101A → T.
Corresponds to variant rs16853331 [ dbSNP | Ensembl ].
VAR_038460
Natural varianti2975 – 29751Y → C.
Corresponds to variant rs3749003 [ dbSNP | Ensembl ].
VAR_038461
Natural varianti3022 – 30221I → V.
Corresponds to variant rs3749004 [ dbSNP | Ensembl ].
VAR_038462
Natural varianti3202 – 32021G → E.
Corresponds to variant rs16853333 [ dbSNP | Ensembl ].
VAR_038463
Isoform 4 (identifier: A4UGR9-4)
Natural varianti757 – 7571R → G.
Corresponds to variant rs3749005 [ dbSNP | Ensembl ].
Natural varianti885 – 8851V → G.
Corresponds to variant rs3749006 [ dbSNP | Ensembl ].
Natural varianti905 – 9051E → Q.
Corresponds to variant rs16853344 [ dbSNP | Ensembl ].

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4747Missing in isoform 2 and isoform 7. 1 PublicationVSP_030846Add
BLAST
Alternative sequencei1 – 11M → MFPMQKGSLNLLRQKWESCD YQRSECHPRDSHCTIFQPQE SKLLAPEGEVVSAPQSLDPT SLPYSTGEEMWSSKPEEKDS VDKSNNTREYGRPEVLKEDS LSSRRRIERFSIALDELRSV FEAPKSGNKPAEYGGKEVEI ERSLCSPAFKSHPGSQLEDS VKDSDKKGKETSFDKM in isoform 4, isoform 6 and isoform 8. 1 PublicationVSP_035717
Alternative sequencei13 – 131A → AVFSTDQAQILRLHLHPKLT KTPKNSLKSSTYIS in isoform 6. 1 PublicationVSP_035718
Alternative sequencei218 – 771554TESEY…RGDVK → KLLLQDKEICILCQKTVYPM ECLVADKQNFHKSCFRCHHC NSKLSLGNYASLHGQIYCKP HFKQLFKSKGNYDEGFGHKQ HKDRWNCKNQSRSVDFIPNE EPNMCKNIAENTLVPGDRNE HLDAGNSEGQRNDLRKLGER GKLKVIWPPSKEIPKKTLPF EEELKMSKPKWPPEMTTLLS PEFKSESLLEDVRTPENKGQ RQDHFPFLQPYLQSTHVCQK EDVIGIKEMKMPEGRKDEKK EGRKNVQDRPSEAEDTKSNR KSAMDLNDNNNVIVQSAEKE KNEKTNQTNGAEVLQVTNTD DEMMPENHKENLNKNNNNNY VAVSYLNNCRQKTSILEFLD LLPLSSEANDTANEYEIEKL ENTSRISELLGIFESEKTYS RNVLAMALKKQTDRAAAGSP VQPAPKPSLSRGLMVKGGSS IISPDTNLLNIKGSHSKSKN LHFFFSNTVKITAFSKKNEN IFNCDLIDSVDQIKNMPCLD LREFGKDVKPWHVETTEAAR NNENTGFDALSHECTAKPLF PRVEVQSEQLTVEEQIKRNR CYSDTE in isoform 4, isoform 5, isoform 6 and isoform 7. 2 PublicationsVSP_035719Add
BLAST
Alternative sequencei772 – 33742603Missing in isoform 4, isoform 5, isoform 6 and isoform 7. 2 PublicationsVSP_035720Add
BLAST
Alternative sequencei3344 – 33452EA → GK in isoform 3. 1 PublicationVSP_030847
Alternative sequencei3346 – 337429Missing in isoform 3. 1 PublicationVSP_030848Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY820969 mRNA. Translation: AAV87913.1.
EF119717 mRNA. Translation: ABO69245.1.
EF119718 mRNA. Translation: ABO69246.1.
EF119719 mRNA. Translation: ABO69247.1.
EF119720 mRNA. Translation: ABO69248.1.
EF119721 mRNA. Translation: ABO69249.1.
EF119722 mRNA. Translation: ABO69250.1.
EF119711 mRNA. Translation: ABO69251.1.
AK096430 mRNA. No translation available.
AK122889 mRNA. Translation: BAG53782.1.
AC093684 Genomic DNA. Translation: AAY24138.1. Different initiation.
AC108494 Genomic DNA. No translation available.
AC133782 Genomic DNA. No translation available.
AC092601 Genomic DNA. No translation available.
CH471058 Genomic DNA. Translation: EAX11311.1.
BC018673 mRNA. Translation: AAH18673.1. Sequence problems.
BC022888 mRNA. No translation available.
AJ626901 mRNA. Translation: CAF25193.1.
AL832331 mRNA. Translation: CAD38624.1. Sequence problems.
AL831970 mRNA. Translation: CAD89919.1.
AL832452 mRNA. Translation: CAD89958.1. Sequence problems.
AL832336 mRNA. Translation: CAD91137.1.
AL831985 mRNA. Translation: CAD91139.1.
AL833291 mRNA. Translation: CAD91141.2. Sequence problems.
AL832011 mRNA. Translation: CAD91146.1.
AL832360 mRNA. Translation: CAD91154.1.
AL832382 mRNA. Translation: CAD91156.1.
CCDSiCCDS42768.1. [A4UGR9-4]
CCDS42769.1. [A4UGR9-8]
CCDS56143.1. [A4UGR9-6]
CCDS56144.1. [A4UGR9-2]
CCDS56145.1. [A4UGR9-7]
RefSeqiNP_001073278.1. NM_001079810.3. [A4UGR9-4]
NP_001186072.1. NM_001199143.1. [A4UGR9-6]
NP_001186073.1. NM_001199144.1. [A4UGR9-2]
NP_001186074.1. NM_001199145.1. [A4UGR9-7]
NP_689594.4. NM_152381.5. [A4UGR9-8]
UniGeneiHs.73680.

Genome annotation databases

EnsembliENST00000409043; ENSP00000386454; ENSG00000163092. [A4UGR9-4]
ENST00000409195; ENSP00000386840; ENSG00000163092. [A4UGR9-8]
ENST00000409273; ENSP00000387255; ENSG00000163092. [A4UGR9-2]
ENST00000409605; ENSP00000386981; ENSG00000163092. [A4UGR9-7]
ENST00000409728; ENSP00000386619; ENSG00000163092. [A4UGR9-6]
ENST00000628543; ENSP00000486198; ENSG00000163092. [A4UGR9-1]
GeneIDi129446.
KEGGihsa:129446.
UCSCiuc002udx.4. human. [A4UGR9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY820969 mRNA. Translation: AAV87913.1.
EF119717 mRNA. Translation: ABO69245.1.
EF119718 mRNA. Translation: ABO69246.1.
EF119719 mRNA. Translation: ABO69247.1.
EF119720 mRNA. Translation: ABO69248.1.
EF119721 mRNA. Translation: ABO69249.1.
EF119722 mRNA. Translation: ABO69250.1.
EF119711 mRNA. Translation: ABO69251.1.
AK096430 mRNA. No translation available.
AK122889 mRNA. Translation: BAG53782.1.
AC093684 Genomic DNA. Translation: AAY24138.1. Different initiation.
AC108494 Genomic DNA. No translation available.
AC133782 Genomic DNA. No translation available.
AC092601 Genomic DNA. No translation available.
CH471058 Genomic DNA. Translation: EAX11311.1.
BC018673 mRNA. Translation: AAH18673.1. Sequence problems.
BC022888 mRNA. No translation available.
AJ626901 mRNA. Translation: CAF25193.1.
AL832331 mRNA. Translation: CAD38624.1. Sequence problems.
AL831970 mRNA. Translation: CAD89919.1.
AL832452 mRNA. Translation: CAD89958.1. Sequence problems.
AL832336 mRNA. Translation: CAD91137.1.
AL831985 mRNA. Translation: CAD91139.1.
AL833291 mRNA. Translation: CAD91141.2. Sequence problems.
AL832011 mRNA. Translation: CAD91146.1.
AL832360 mRNA. Translation: CAD91154.1.
AL832382 mRNA. Translation: CAD91156.1.
CCDSiCCDS42768.1. [A4UGR9-4]
CCDS42769.1. [A4UGR9-8]
CCDS56143.1. [A4UGR9-6]
CCDS56144.1. [A4UGR9-2]
CCDS56145.1. [A4UGR9-7]
RefSeqiNP_001073278.1. NM_001079810.3. [A4UGR9-4]
NP_001186072.1. NM_001199143.1. [A4UGR9-6]
NP_001186073.1. NM_001199144.1. [A4UGR9-2]
NP_001186074.1. NM_001199145.1. [A4UGR9-7]
NP_689594.4. NM_152381.5. [A4UGR9-8]
UniGeneiHs.73680.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4F14X-ray1.20B2245-2257[»]
ProteinModelPortaliA4UGR9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126192. 6 interactions.
IntActiA4UGR9. 3 interactions.
STRINGi9606.ENSP00000295237.

PTM databases

iPTMnetiA4UGR9.
PhosphoSiteiA4UGR9.

Polymorphism and mutation databases

BioMutaiXIRP2.

Proteomic databases

EPDiA4UGR9.
PaxDbiA4UGR9.
PeptideAtlasiA4UGR9.
PRIDEiA4UGR9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409043; ENSP00000386454; ENSG00000163092. [A4UGR9-4]
ENST00000409195; ENSP00000386840; ENSG00000163092. [A4UGR9-8]
ENST00000409273; ENSP00000387255; ENSG00000163092. [A4UGR9-2]
ENST00000409605; ENSP00000386981; ENSG00000163092. [A4UGR9-7]
ENST00000409728; ENSP00000386619; ENSG00000163092. [A4UGR9-6]
ENST00000628543; ENSP00000486198; ENSG00000163092. [A4UGR9-1]
GeneIDi129446.
KEGGihsa:129446.
UCSCiuc002udx.4. human. [A4UGR9-1]

Organism-specific databases

CTDi129446.
GeneCardsiXIRP2.
H-InvDBHIX0161911.
HGNCiHGNC:14303. XIRP2.
HPAiHPA034813.
MIMi609778. gene.
neXtProtiNX_A4UGR9.
PharmGKBiPA162409337.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IF8Z. Eukaryota.
ENOG410ZM11. LUCA.
GeneTreeiENSGT00530000063779.
HOVERGENiHBG108682.
InParanoidiA4UGR9.
OMAiRYMFETQ.
OrthoDBiEOG7M0NQJ.
PhylomeDBiA4UGR9.

Miscellaneous databases

ChiTaRSiXIRP2. human.
GeneWikiiXIRP2.
GenomeRNAii129446.
PROiA4UGR9.
SOURCEiSearch...

Gene expression databases

BgeeiA4UGR9.
ExpressionAtlasiA4UGR9. baseline and differential.
GenevisibleiA4UGR9. HS.

Family and domain databases

InterProiIPR012510. Actin-binding_Xin_repeat.
IPR030072. XIRP1/XIRP2.
IPR030107. XIRP2.
[Graphical view]
PANTHERiPTHR22591. PTHR22591. 1 hit.
PTHR22591:SF1. PTHR22591:SF1. 1 hit.
PfamiPF08043. Xin. 19 hits.
[Graphical view]
PROSITEiPS51389. XIN. 28 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A novel gene containing a Xin repeat."
    Luo J., Liu M., Wu X.
    Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. "bXin: genes, splice variants and cellular distribution of a family of proteins implicated."
    Wang K., Xie L., Tsai W.L., Gutierrez-Cruz G.
    Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4; 6 AND 7).
    Tissue: Heart and Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 901-1683 (ISOFORMS 1/2/3).
    Tissue: Tongue.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 112-748 (ISOFORMS 1/2/3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3177-3374 (ISOFORMS 1/2).
    Tissue: Skeletal muscle.
  7. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 361-1380 (ISOFORMS 1/2/3), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN.
    Tissue: Skeletal muscle.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 439-3374 (ISOFORMS 1/2).
    Tissue: Skeletal muscle.

Entry informationi

Entry nameiXIRP2_HUMAN
AccessioniPrimary (citable) accession number: A4UGR9
Secondary accession number(s): A0PJ94
, B2BBS0, B2BBS1, B2BBS4, B3KVH0, J3KNB1, Q53R52, Q5MJ67, Q702N7, Q86T36, Q86T38, Q86T46, Q86T51, Q86T53, Q86T55, Q86T79, Q86TB6, Q8N1M9, Q8N3R5, Q8TBV6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: July 6, 2016
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

'Xin' means 'heart' in Chinese.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.