Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A4QPC6 (BT2A2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 62. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Butyrophilin subfamily 2 member A2
Gene names
Name:Btn2a2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length514 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. Ref.3

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Tissue specificity

Widely expressed (at protein level). In the thymus, restricted to the corticomedullary junction, but not confined solely to epithelial cells (at protein level). Significant expression on naive B-cells, splenic natural killer cells, dendritic cells and peritoneal macrophages (at protein level). Negligible expression on naive T-cells up-regulated on activated T-cells (at protein level). Ref.3

Post-translational modification

N-glycosylated. Ref.3

Sequence similarities

Belongs to the immunoglobulin superfamily. BTN/MOG family.

Contains 1 B30.2/SPRY domain.

Contains 1 Ig-like C2-type (immunoglobulin-like) domain.

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A4QPC6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A4QPC6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     372-400: Missing.
     422-451: IIPLKERLHRIAVFLDCEGGDISFYNMRDR → DHTSERASSPYSCLPGL
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Chain30 – 514485Butyrophilin subfamily 2 member A2
PRO_0000367054

Regions

Topological domain30 – 244215Extracellular Potential
Transmembrane245 – 26521Helical; Potential
Topological domain266 – 514249Cytoplasmic Potential
Domain30 – 142113Ig-like V-type
Domain150 – 23283Ig-like C2-type
Domain295 – 488194B30.2/SPRY
Coiled coil281 – 30424 Potential

Amino acid modifications

Glycosylation471N-linked (GlcNAc...) Potential
Glycosylation1151N-linked (GlcNAc...) Potential
Disulfide bond52 ↔ 126 By similarity
Disulfide bond166 ↔ 220 By similarity

Natural variations

Alternative sequence372 – 40029Missing in isoform 2.
VSP_036621
Alternative sequence422 – 45130IIPLK…NMRDR → DHTSERASSPYSCLPGL in isoform 2.
VSP_036622

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 5, 2008. Version 1.
Checksum: 2C988E1520BE11F1

FASTA51458,455
        10         20         30         40         50         60 
MEPTTSLRSC PIASLLFFLV LSLFVLVSAQ FTVIGPAEPI LAMVGENTTL HCHLSPERNA 

        70         80         90        100        110        120 
EEMEVRWFRW RFFPAVLVYR GHQERPEEQM VAYRGRTTFM RTDISKGRVA LIIHNVTAYD 

       130        140        150        160        170        180 
NGIYCCYFQE GRSYDQATMK LMVASLGSEP LIKMKTLEDG SILLECTSEG WYPEPRAVWR 

       190        200        210        220        230        240 
DPYDEVVPAL EEEYTADREG LFTVTMTIII RDCSVRNMTC SVNNTLLSQE VESVILIPES 

       250        260        270        280        290        300 
FVPSLPLWMV AVAVTLPVVM LILLTSGSIC LVKKHRRKKS ILSAEKEAEY EEKEAARQLQ 

       310        320        330        340        350        360 
EELRWRRTLL HAADVVLDPD TAHPELFLSD DQRSVIRGSS RQSVPDNPER FDCRPCVLGR 

       370        380        390        400        410        420 
ESFSSGKHYW EVEVENVMVW AIGVCRDSVE RKGEALLVPQ NGFWTLEMFG SQYRALSSPE 

       430        440        450        460        470        480 
KIIPLKERLH RIAVFLDCEG GDISFYNMRD RSHIYTCPPV TFTGPLRPFF RLGSDDSPLF 

       490        500        510 
ICPAFTGAQG VTIPEGGLFL YKTRPISQSL VRKP 

« Hide

Isoform 2 [UniParc].

Checksum: D787E148EE5E5721
Show »

FASTA47253,488

References

« Hide 'large scale' references
[1]"Comparison of the butyrophilin cluster in human and mouse."
Meyer M., Trowsdale J.
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation."
Smith I.A., Knezevic B.R., Ammann J.U., Rhodes D.A., Aw D., Palmer D.B., Mather I.H., Trowsdale J.
J. Immunol. 184:3514-3525(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, GLYCOSYLATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY177686 mRNA. Translation: AAO38196.1.
BC139760 mRNA. Translation: AAI39761.1.
CCDSCCDS36619.1. [A4QPC6-1]
RefSeqNP_001276544.1. NM_001289615.1. [A4QPC6-1]
NP_787952.2. NM_175938.3. [A4QPC6-1]
XP_006516727.1. XM_006516664.1. [A4QPC6-1]
UniGeneMm.129668.

3D structure databases

ProteinModelPortalA4QPC6.
SMRA4QPC6. Positions 29-238, 311-483.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10090.ENSMUSP00000106062.

PTM databases

PhosphoSiteA4QPC6.

Proteomic databases

PRIDEA4QPC6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000110432; ENSMUSP00000106062; ENSMUSG00000053216. [A4QPC6-1]
ENSMUST00000110433; ENSMUSP00000106063; ENSMUSG00000053216. [A4QPC6-1]
GeneID238555.
KEGGmmu:238555.
UCSCuc007ptu.1. mouse. [A4QPC6-1]

Organism-specific databases

CTD10385.
MGIMGI:3606486. Btn2a2.

Phylogenomic databases

eggNOGNOG45068.
GeneTreeENSGT00750000117323.
HOGENOMHOG000230860.
HOVERGENHBG050747.
InParanoidA4QPC6.
KOK06712.
OMATSGSICL.
TreeFamTF331083.

Gene expression databases

BgeeA4QPC6.
GenevestigatorA4QPC6.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013162. CD80_C2-set.
IPR008985. ConA-like_lec_gl_sf.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR006574. PRY.
IPR018355. SPla/RYanodine_receptor_subgr.
IPR003877. SPRY_rcpt.
[Graphical view]
PfamPF08205. C2-set_2. 1 hit.
PF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
PRINTSPR01407. BUTYPHLNCDUF.
SMARTSM00409. IG. 1 hit.
SM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMSSF49899. SSF49899. 1 hit.
PROSITEPS50188. B302_SPRY. 1 hit.
PS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio383816.
PROA4QPC6.
SOURCESearch...

Entry information

Entry nameBT2A2_MOUSE
AccessionPrimary (citable) accession number: A4QPC6
Secondary accession number(s): Q811T8
Entry history
Integrated into UniProtKB/Swiss-Prot: March 24, 2009
Last sequence update: February 5, 2008
Last modified: July 9, 2014
This is version 62 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot