Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A4QPC6

- BT2A2_MOUSE

UniProt

A4QPC6 - BT2A2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Butyrophilin subfamily 2 member A2

Gene

Btn2a2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.1 Publication

GO - Biological processi

  1. negative regulation of activated T cell proliferation Source: UniProtKB
  2. negative regulation of cellular metabolic process Source: UniProtKB
  3. negative regulation of cytokine secretion Source: UniProtKB
  4. negative regulation of ERK1 and ERK2 cascade Source: MGI
  5. negative regulation of G1/S transition of mitotic cell cycle Source: MGI
  6. negative regulation of phosphatidylinositol 3-kinase signaling Source: MGI
  7. negative regulation of protein kinase B signaling Source: MGI
  8. negative regulation of T cell receptor signaling pathway Source: MGI
  9. positive regulation of regulatory T cell differentiation Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Butyrophilin subfamily 2 member A2
Gene namesi
Name:Btn2a2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:3606486. Btn2a2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 244215ExtracellularSequence AnalysisAdd
BLAST
Transmembranei245 – 26521HelicalSequence AnalysisAdd
BLAST
Topological domaini266 – 514249CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cell surface Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Chaini30 – 514485Butyrophilin subfamily 2 member A2PRO_0000367054Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi47 – 471N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi52 ↔ 126PROSITE-ProRule annotation
Glycosylationi115 – 1151N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi166 ↔ 220PROSITE-ProRule annotation

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiA4QPC6.

PTM databases

PhosphoSiteiA4QPC6.

Expressioni

Tissue specificityi

Widely expressed (at protein level). In the thymus, restricted to the corticomedullary junction, but not confined solely to epithelial cells (at protein level). Significant expression on naive B-cells, splenic natural killer cells, dendritic cells and peritoneal macrophages (at protein level). Negligible expression on naive T-cells up-regulated on activated T-cells (at protein level).1 Publication

Gene expression databases

BgeeiA4QPC6.
ExpressionAtlasiA4QPC6. differential.
GenevestigatoriA4QPC6.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000106062.

Structurei

3D structure databases

ProteinModelPortaliA4QPC6.
SMRiA4QPC6. Positions 29-238, 305-484.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini30 – 142113Ig-like V-typeAdd
BLAST
Domaini150 – 23283Ig-like C2-typeAdd
BLAST
Domaini295 – 488194B30.2/SPRYPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili281 – 30424Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 B30.2/SPRY domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG45068.
GeneTreeiENSGT00760000118933.
HOGENOMiHOG000230860.
HOVERGENiHBG050747.
InParanoidiA4QPC6.
KOiK06712.
OMAiTSGSICL.
TreeFamiTF331083.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013162. CD80_C2-set.
IPR013320. ConA-like_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR006574. PRY.
IPR003877. SPRY_dom.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00409. IG. 1 hit.
SM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
PS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A4QPC6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPTTSLRSC PIASLLFFLV LSLFVLVSAQ FTVIGPAEPI LAMVGENTTL
60 70 80 90 100
HCHLSPERNA EEMEVRWFRW RFFPAVLVYR GHQERPEEQM VAYRGRTTFM
110 120 130 140 150
RTDISKGRVA LIIHNVTAYD NGIYCCYFQE GRSYDQATMK LMVASLGSEP
160 170 180 190 200
LIKMKTLEDG SILLECTSEG WYPEPRAVWR DPYDEVVPAL EEEYTADREG
210 220 230 240 250
LFTVTMTIII RDCSVRNMTC SVNNTLLSQE VESVILIPES FVPSLPLWMV
260 270 280 290 300
AVAVTLPVVM LILLTSGSIC LVKKHRRKKS ILSAEKEAEY EEKEAARQLQ
310 320 330 340 350
EELRWRRTLL HAADVVLDPD TAHPELFLSD DQRSVIRGSS RQSVPDNPER
360 370 380 390 400
FDCRPCVLGR ESFSSGKHYW EVEVENVMVW AIGVCRDSVE RKGEALLVPQ
410 420 430 440 450
NGFWTLEMFG SQYRALSSPE KIIPLKERLH RIAVFLDCEG GDISFYNMRD
460 470 480 490 500
RSHIYTCPPV TFTGPLRPFF RLGSDDSPLF ICPAFTGAQG VTIPEGGLFL
510
YKTRPISQSL VRKP
Length:514
Mass (Da):58,455
Last modified:February 5, 2008 - v1
Checksum:i2C988E1520BE11F1
GO
Isoform 2 (identifier: A4QPC6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-400: Missing.
     422-451: IIPLKERLHRIAVFLDCEGGDISFYNMRDR → DHTSERASSPYSCLPGL

Note: No experimental confirmation available.

Show »
Length:472
Mass (Da):53,488
Checksum:iD787E148EE5E5721
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei372 – 40029Missing in isoform 2. 1 PublicationVSP_036621Add
BLAST
Alternative sequencei422 – 45130IIPLK…NMRDR → DHTSERASSPYSCLPGL in isoform 2. 1 PublicationVSP_036622Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY177686 mRNA. Translation: AAO38196.1.
BC139760 mRNA. Translation: AAI39761.1.
CCDSiCCDS36619.1. [A4QPC6-1]
RefSeqiNP_001276544.1. NM_001289615.1. [A4QPC6-1]
NP_787952.2. NM_175938.3. [A4QPC6-1]
XP_006516727.1. XM_006516664.1. [A4QPC6-1]
UniGeneiMm.129668.

Genome annotation databases

EnsembliENSMUST00000110432; ENSMUSP00000106062; ENSMUSG00000053216. [A4QPC6-1]
ENSMUST00000110433; ENSMUSP00000106063; ENSMUSG00000053216. [A4QPC6-1]
GeneIDi238555.
KEGGimmu:238555.
UCSCiuc007ptu.1. mouse. [A4QPC6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY177686 mRNA. Translation: AAO38196.1 .
BC139760 mRNA. Translation: AAI39761.1 .
CCDSi CCDS36619.1. [A4QPC6-1 ]
RefSeqi NP_001276544.1. NM_001289615.1. [A4QPC6-1 ]
NP_787952.2. NM_175938.3. [A4QPC6-1 ]
XP_006516727.1. XM_006516664.1. [A4QPC6-1 ]
UniGenei Mm.129668.

3D structure databases

ProteinModelPortali A4QPC6.
SMRi A4QPC6. Positions 29-238, 305-484.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000106062.

PTM databases

PhosphoSitei A4QPC6.

Proteomic databases

PRIDEi A4QPC6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000110432 ; ENSMUSP00000106062 ; ENSMUSG00000053216 . [A4QPC6-1 ]
ENSMUST00000110433 ; ENSMUSP00000106063 ; ENSMUSG00000053216 . [A4QPC6-1 ]
GeneIDi 238555.
KEGGi mmu:238555.
UCSCi uc007ptu.1. mouse. [A4QPC6-1 ]

Organism-specific databases

CTDi 10385.
MGIi MGI:3606486. Btn2a2.

Phylogenomic databases

eggNOGi NOG45068.
GeneTreei ENSGT00760000118933.
HOGENOMi HOG000230860.
HOVERGENi HBG050747.
InParanoidi A4QPC6.
KOi K06712.
OMAi TSGSICL.
TreeFami TF331083.

Miscellaneous databases

NextBioi 383816.
PROi A4QPC6.
SOURCEi Search...

Gene expression databases

Bgeei A4QPC6.
ExpressionAtlasi A4QPC6. differential.
Genevestigatori A4QPC6.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013162. CD80_C2-set.
IPR013320. ConA-like_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR006574. PRY.
IPR003877. SPRY_dom.
[Graphical view ]
Pfami PF08205. C2-set_2. 1 hit.
PF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view ]
PRINTSi PR01407. BUTYPHLNCDUF.
SMARTi SM00409. IG. 1 hit.
SM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
PROSITEi PS50188. B302_SPRY. 1 hit.
PS50835. IG_LIKE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Comparison of the butyrophilin cluster in human and mouse."
    Meyer M., Trowsdale J.
    Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation."
    Smith I.A., Knezevic B.R., Ammann J.U., Rhodes D.A., Aw D., Palmer D.B., Mather I.H., Trowsdale J.
    J. Immunol. 184:3514-3525(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, GLYCOSYLATION.

Entry informationi

Entry nameiBT2A2_MOUSE
AccessioniPrimary (citable) accession number: A4QPC6
Secondary accession number(s): Q811T8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 24, 2009
Last sequence update: February 5, 2008
Last modified: October 29, 2014
This is version 64 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3