Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A4QPC6

- BT2A2_MOUSE

UniProt

A4QPC6 - BT2A2_MOUSE

Protein

Butyrophilin subfamily 2 member A2

Gene

Btn2a2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 63 (01 Oct 2014)
      Sequence version 1 (05 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.1 Publication

    GO - Biological processi

    1. negative regulation of activated T cell proliferation Source: UniProtKB
    2. negative regulation of cellular metabolic process Source: UniProtKB
    3. negative regulation of cytokine secretion Source: UniProtKB
    4. negative regulation of ERK1 and ERK2 cascade Source: MGI
    5. negative regulation of G1/S transition of mitotic cell cycle Source: MGI
    6. negative regulation of phosphatidylinositol 3-kinase signaling Source: MGI
    7. negative regulation of protein kinase B signaling Source: MGI
    8. negative regulation of T cell receptor signaling pathway Source: MGI
    9. positive regulation of regulatory T cell differentiation Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Butyrophilin subfamily 2 member A2
    Gene namesi
    Name:Btn2a2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 13

    Organism-specific databases

    MGIiMGI:3606486. Btn2a2.

    Subcellular locationi

    GO - Cellular componenti

    1. cell surface Source: MGI
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 514485Butyrophilin subfamily 2 member A2PRO_0000367054Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi47 – 471N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi52 ↔ 126PROSITE-ProRule annotation
    Glycosylationi115 – 1151N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi166 ↔ 220PROSITE-ProRule annotation

    Post-translational modificationi

    N-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiA4QPC6.

    PTM databases

    PhosphoSiteiA4QPC6.

    Expressioni

    Tissue specificityi

    Widely expressed (at protein level). In the thymus, restricted to the corticomedullary junction, but not confined solely to epithelial cells (at protein level). Significant expression on naive B-cells, splenic natural killer cells, dendritic cells and peritoneal macrophages (at protein level). Negligible expression on naive T-cells up-regulated on activated T-cells (at protein level).1 Publication

    Gene expression databases

    BgeeiA4QPC6.
    GenevestigatoriA4QPC6.

    Interactioni

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000106062.

    Structurei

    3D structure databases

    ProteinModelPortaliA4QPC6.
    SMRiA4QPC6. Positions 29-238, 311-483.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini30 – 244215ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini266 – 514249CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei245 – 26521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini30 – 142113Ig-like V-typeAdd
    BLAST
    Domaini150 – 23283Ig-like C2-typeAdd
    BLAST
    Domaini295 – 488194B30.2/SPRYPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili281 – 30424Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 B30.2/SPRY domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG45068.
    GeneTreeiENSGT00750000117323.
    HOGENOMiHOG000230860.
    HOVERGENiHBG050747.
    InParanoidiA4QPC6.
    KOiK06712.
    OMAiTSGSICL.
    TreeFamiTF331083.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR001870. B30.2/SPRY.
    IPR003879. Butyrophylin.
    IPR013162. CD80_C2-set.
    IPR008985. ConA-like_lec_gl_sf.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR006574. PRY.
    IPR018355. SPla/RYanodine_receptor_subgr.
    IPR003877. SPRY_rcpt.
    [Graphical view]
    PfamiPF08205. C2-set_2. 1 hit.
    PF13765. PRY. 1 hit.
    PF00622. SPRY. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    PRINTSiPR01407. BUTYPHLNCDUF.
    SMARTiSM00409. IG. 1 hit.
    SM00589. PRY. 1 hit.
    SM00449. SPRY. 1 hit.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 1 hit.
    PROSITEiPS50188. B302_SPRY. 1 hit.
    PS50835. IG_LIKE. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A4QPC6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEPTTSLRSC PIASLLFFLV LSLFVLVSAQ FTVIGPAEPI LAMVGENTTL    50
    HCHLSPERNA EEMEVRWFRW RFFPAVLVYR GHQERPEEQM VAYRGRTTFM 100
    RTDISKGRVA LIIHNVTAYD NGIYCCYFQE GRSYDQATMK LMVASLGSEP 150
    LIKMKTLEDG SILLECTSEG WYPEPRAVWR DPYDEVVPAL EEEYTADREG 200
    LFTVTMTIII RDCSVRNMTC SVNNTLLSQE VESVILIPES FVPSLPLWMV 250
    AVAVTLPVVM LILLTSGSIC LVKKHRRKKS ILSAEKEAEY EEKEAARQLQ 300
    EELRWRRTLL HAADVVLDPD TAHPELFLSD DQRSVIRGSS RQSVPDNPER 350
    FDCRPCVLGR ESFSSGKHYW EVEVENVMVW AIGVCRDSVE RKGEALLVPQ 400
    NGFWTLEMFG SQYRALSSPE KIIPLKERLH RIAVFLDCEG GDISFYNMRD 450
    RSHIYTCPPV TFTGPLRPFF RLGSDDSPLF ICPAFTGAQG VTIPEGGLFL 500
    YKTRPISQSL VRKP 514
    Length:514
    Mass (Da):58,455
    Last modified:February 5, 2008 - v1
    Checksum:i2C988E1520BE11F1
    GO
    Isoform 2 (identifier: A4QPC6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         372-400: Missing.
         422-451: IIPLKERLHRIAVFLDCEGGDISFYNMRDR → DHTSERASSPYSCLPGL

    Note: No experimental confirmation available.

    Show »
    Length:472
    Mass (Da):53,488
    Checksum:iD787E148EE5E5721
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei372 – 40029Missing in isoform 2. 1 PublicationVSP_036621Add
    BLAST
    Alternative sequencei422 – 45130IIPLK…NMRDR → DHTSERASSPYSCLPGL in isoform 2. 1 PublicationVSP_036622Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY177686 mRNA. Translation: AAO38196.1.
    BC139760 mRNA. Translation: AAI39761.1.
    CCDSiCCDS36619.1. [A4QPC6-1]
    RefSeqiNP_001276544.1. NM_001289615.1. [A4QPC6-1]
    NP_787952.2. NM_175938.3. [A4QPC6-1]
    XP_006516727.1. XM_006516664.1. [A4QPC6-1]
    UniGeneiMm.129668.

    Genome annotation databases

    EnsembliENSMUST00000110432; ENSMUSP00000106062; ENSMUSG00000053216. [A4QPC6-1]
    ENSMUST00000110433; ENSMUSP00000106063; ENSMUSG00000053216. [A4QPC6-1]
    GeneIDi238555.
    KEGGimmu:238555.
    UCSCiuc007ptu.1. mouse. [A4QPC6-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY177686 mRNA. Translation: AAO38196.1 .
    BC139760 mRNA. Translation: AAI39761.1 .
    CCDSi CCDS36619.1. [A4QPC6-1 ]
    RefSeqi NP_001276544.1. NM_001289615.1. [A4QPC6-1 ]
    NP_787952.2. NM_175938.3. [A4QPC6-1 ]
    XP_006516727.1. XM_006516664.1. [A4QPC6-1 ]
    UniGenei Mm.129668.

    3D structure databases

    ProteinModelPortali A4QPC6.
    SMRi A4QPC6. Positions 29-238, 311-483.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000106062.

    PTM databases

    PhosphoSitei A4QPC6.

    Proteomic databases

    PRIDEi A4QPC6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000110432 ; ENSMUSP00000106062 ; ENSMUSG00000053216 . [A4QPC6-1 ]
    ENSMUST00000110433 ; ENSMUSP00000106063 ; ENSMUSG00000053216 . [A4QPC6-1 ]
    GeneIDi 238555.
    KEGGi mmu:238555.
    UCSCi uc007ptu.1. mouse. [A4QPC6-1 ]

    Organism-specific databases

    CTDi 10385.
    MGIi MGI:3606486. Btn2a2.

    Phylogenomic databases

    eggNOGi NOG45068.
    GeneTreei ENSGT00750000117323.
    HOGENOMi HOG000230860.
    HOVERGENi HBG050747.
    InParanoidi A4QPC6.
    KOi K06712.
    OMAi TSGSICL.
    TreeFami TF331083.

    Miscellaneous databases

    NextBioi 383816.
    PROi A4QPC6.
    SOURCEi Search...

    Gene expression databases

    Bgeei A4QPC6.
    Genevestigatori A4QPC6.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR001870. B30.2/SPRY.
    IPR003879. Butyrophylin.
    IPR013162. CD80_C2-set.
    IPR008985. ConA-like_lec_gl_sf.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR006574. PRY.
    IPR018355. SPla/RYanodine_receptor_subgr.
    IPR003877. SPRY_rcpt.
    [Graphical view ]
    Pfami PF08205. C2-set_2. 1 hit.
    PF13765. PRY. 1 hit.
    PF00622. SPRY. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    PRINTSi PR01407. BUTYPHLNCDUF.
    SMARTi SM00409. IG. 1 hit.
    SM00589. PRY. 1 hit.
    SM00449. SPRY. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 1 hit.
    PROSITEi PS50188. B302_SPRY. 1 hit.
    PS50835. IG_LIKE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Comparison of the butyrophilin cluster in human and mouse."
      Meyer M., Trowsdale J.
      Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation."
      Smith I.A., Knezevic B.R., Ammann J.U., Rhodes D.A., Aw D., Palmer D.B., Mather I.H., Trowsdale J.
      J. Immunol. 184:3514-3525(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, GLYCOSYLATION.

    Entry informationi

    Entry nameiBT2A2_MOUSE
    AccessioniPrimary (citable) accession number: A4QPC6
    Secondary accession number(s): Q811T8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 24, 2009
    Last sequence update: February 5, 2008
    Last modified: October 1, 2014
    This is version 63 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3