Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Butyrophilin subfamily 2 member A2

Gene

Btn2a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.1 Publication

GO - Biological processi

  • negative regulation of activated T cell proliferation Source: UniProtKB
  • negative regulation of cellular metabolic process Source: UniProtKB
  • negative regulation of cytokine secretion Source: UniProtKB
  • negative regulation of ERK1 and ERK2 cascade Source: MGI
  • negative regulation of G1/S transition of mitotic cell cycle Source: MGI
  • negative regulation of phosphatidylinositol 3-kinase signaling Source: MGI
  • negative regulation of protein kinase B signaling Source: MGI
  • negative regulation of T cell receptor signaling pathway Source: MGI
  • positive regulation of regulatory T cell differentiation Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Butyrophilin subfamily 2 member A2
Gene namesi
Name:Btn2a2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:3606486. Btn2a2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 244ExtracellularSequence analysisAdd BLAST215
Transmembranei245 – 265HelicalSequence analysisAdd BLAST21
Topological domaini266 – 514CytoplasmicSequence analysisAdd BLAST249

GO - Cellular componenti

  • cell surface Source: MGI
  • extracellular exosome Source: MGI
  • integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000036705430 – 514Butyrophilin subfamily 2 member A2Add BLAST485

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi52 ↔ 126PROSITE-ProRule annotation
Glycosylationi115N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi166 ↔ 220PROSITE-ProRule annotation

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiA4QPC6.
PRIDEiA4QPC6.

PTM databases

iPTMnetiA4QPC6.
PhosphoSitePlusiA4QPC6.

Expressioni

Tissue specificityi

Widely expressed (at protein level). In the thymus, restricted to the corticomedullary junction, but not confined solely to epithelial cells (at protein level). Significant expression on naive B-cells, splenic natural killer cells, dendritic cells and peritoneal macrophages (at protein level). Negligible expression on naive T-cells up-regulated on activated T-cells (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000053216.
ExpressionAtlasiA4QPC6. baseline and differential.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000106062.

Structurei

3D structure databases

ProteinModelPortaliA4QPC6.
SMRiA4QPC6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 142Ig-like V-typeAdd BLAST113
Domaini150 – 232Ig-like C2-typeAdd BLAST83
Domaini295 – 488B30.2/SPRYPROSITE-ProRule annotationAdd BLAST194

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili281 – 304Sequence analysisAdd BLAST24

Sequence similaritiesi

Contains 1 B30.2/SPRY domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJI4. Eukaryota.
ENOG410YA6W. LUCA.
GeneTreeiENSGT00760000118933.
HOGENOMiHOG000230860.
HOVERGENiHBG050747.
InParanoidiA4QPC6.
KOiK06712.
OMAiTSGSICL.
OrthoDBiEOG091G07OP.
TreeFamiTF331083.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013320. ConA-like_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR006574. PRY.
IPR003877. SPRY_dom.
[Graphical view]
PfamiPF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
SM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
PS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A4QPC6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPTTSLRSC PIASLLFFLV LSLFVLVSAQ FTVIGPAEPI LAMVGENTTL
60 70 80 90 100
HCHLSPERNA EEMEVRWFRW RFFPAVLVYR GHQERPEEQM VAYRGRTTFM
110 120 130 140 150
RTDISKGRVA LIIHNVTAYD NGIYCCYFQE GRSYDQATMK LMVASLGSEP
160 170 180 190 200
LIKMKTLEDG SILLECTSEG WYPEPRAVWR DPYDEVVPAL EEEYTADREG
210 220 230 240 250
LFTVTMTIII RDCSVRNMTC SVNNTLLSQE VESVILIPES FVPSLPLWMV
260 270 280 290 300
AVAVTLPVVM LILLTSGSIC LVKKHRRKKS ILSAEKEAEY EEKEAARQLQ
310 320 330 340 350
EELRWRRTLL HAADVVLDPD TAHPELFLSD DQRSVIRGSS RQSVPDNPER
360 370 380 390 400
FDCRPCVLGR ESFSSGKHYW EVEVENVMVW AIGVCRDSVE RKGEALLVPQ
410 420 430 440 450
NGFWTLEMFG SQYRALSSPE KIIPLKERLH RIAVFLDCEG GDISFYNMRD
460 470 480 490 500
RSHIYTCPPV TFTGPLRPFF RLGSDDSPLF ICPAFTGAQG VTIPEGGLFL
510
YKTRPISQSL VRKP
Length:514
Mass (Da):58,455
Last modified:February 5, 2008 - v1
Checksum:i2C988E1520BE11F1
GO
Isoform 2 (identifier: A4QPC6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-400: Missing.
     422-451: IIPLKERLHRIAVFLDCEGGDISFYNMRDR → DHTSERASSPYSCLPGL

Note: No experimental confirmation available.
Show »
Length:472
Mass (Da):53,488
Checksum:iD787E148EE5E5721
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036621372 – 400Missing in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_036622422 – 451IIPLK…NMRDR → DHTSERASSPYSCLPGL in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY177686 mRNA. Translation: AAO38196.1.
BC139760 mRNA. Translation: AAI39761.1.
CCDSiCCDS36619.1. [A4QPC6-1]
RefSeqiNP_001276544.1. NM_001289615.1. [A4QPC6-1]
NP_787952.2. NM_175938.3. [A4QPC6-1]
XP_006516727.1. XM_006516664.1. [A4QPC6-1]
UniGeneiMm.129668.

Genome annotation databases

EnsembliENSMUST00000110432; ENSMUSP00000106062; ENSMUSG00000053216. [A4QPC6-1]
ENSMUST00000110433; ENSMUSP00000106063; ENSMUSG00000053216. [A4QPC6-1]
GeneIDi238555.
KEGGimmu:238555.
UCSCiuc007ptu.1. mouse. [A4QPC6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY177686 mRNA. Translation: AAO38196.1.
BC139760 mRNA. Translation: AAI39761.1.
CCDSiCCDS36619.1. [A4QPC6-1]
RefSeqiNP_001276544.1. NM_001289615.1. [A4QPC6-1]
NP_787952.2. NM_175938.3. [A4QPC6-1]
XP_006516727.1. XM_006516664.1. [A4QPC6-1]
UniGeneiMm.129668.

3D structure databases

ProteinModelPortaliA4QPC6.
SMRiA4QPC6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000106062.

PTM databases

iPTMnetiA4QPC6.
PhosphoSitePlusiA4QPC6.

Proteomic databases

PaxDbiA4QPC6.
PRIDEiA4QPC6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000110432; ENSMUSP00000106062; ENSMUSG00000053216. [A4QPC6-1]
ENSMUST00000110433; ENSMUSP00000106063; ENSMUSG00000053216. [A4QPC6-1]
GeneIDi238555.
KEGGimmu:238555.
UCSCiuc007ptu.1. mouse. [A4QPC6-1]

Organism-specific databases

CTDi10385.
MGIiMGI:3606486. Btn2a2.

Phylogenomic databases

eggNOGiENOG410IJI4. Eukaryota.
ENOG410YA6W. LUCA.
GeneTreeiENSGT00760000118933.
HOGENOMiHOG000230860.
HOVERGENiHBG050747.
InParanoidiA4QPC6.
KOiK06712.
OMAiTSGSICL.
OrthoDBiEOG091G07OP.
TreeFamiTF331083.

Miscellaneous databases

PROiA4QPC6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000053216.
ExpressionAtlasiA4QPC6. baseline and differential.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013320. ConA-like_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR006574. PRY.
IPR003877. SPRY_dom.
[Graphical view]
PfamiPF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
SM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
PS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBT2A2_MOUSE
AccessioniPrimary (citable) accession number: A4QPC6
Secondary accession number(s): Q811T8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 24, 2009
Last sequence update: February 5, 2008
Last modified: November 2, 2016
This is version 78 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.