Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin polyglutamylase TTLL11

Gene

Ttll11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Polyglutamase which preferentially modifies alpha-tubulin (PubMed:17499049). Involved in the side-chain elongation step of the polyglutamylation reaction rather than in the initiation step. Required for CCSAP localization to both spindle and cilia microtubules (PubMed:17499049). Generates long side-chains (PubMed:20530212).2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei292 – 2921ATPBy similarity
Binding sitei294 – 2941ATPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi279 – 2824ATP bindingBy similarity

GO - Molecular functioni

GO - Biological processi

  • microtubule severing Source: MGI
  • protein polyglutamylation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin polyglutamylase TTLL11 (EC:6.-.-.-)
Alternative name(s):
Tubulin--tyrosine ligase-like protein 11
Gene namesi
Name:Ttll11Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1921660. Ttll11.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 727727Tubulin polyglutamylase TTLL11PRO_0000326165Add
BLAST

Proteomic databases

PaxDbiA4Q9F4.
PRIDEiA4Q9F4.

PTM databases

PhosphoSiteiA4Q9F4.

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain, kidney, liver, lung, muscle and testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000026885.
CleanExiMM_TTLL11.
ExpressionAtlasiA4Q9F4. baseline and differential.
GenevisibleiA4Q9F4. MM.

Structurei

3D structure databases

ProteinModelPortaliA4Q9F4.
SMRiA4Q9F4. Positions 178-466.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini125 – 477353TTLPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni464 – 566103c-MTBD regionBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi12 – 4736Ala-richSequence analysisAdd
BLAST

Domaini

The flexible c-MTBD (cationic microtubule binding domain) region mediates binding to microtubules. It is positively charged and becomes ordered when bound to microtubules: it interacts with a negatively charged patch on tubulin. The presence of positive charges in the c-MTBD region is essential for proper binding.By similarity

Sequence similaritiesi

Belongs to the tubulin--tyrosine ligase family.Sequence analysis
Contains 1 TTL domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2158. Eukaryota.
ENOG410XNWC. LUCA.
GeneTreeiENSGT00760000118951.
HOGENOMiHOG000001576.
HOVERGENiHBG108615.
InParanoidiA4Q9F4.
KOiK16604.
OMAiACDIYWH.
OrthoDBiEOG091G039J.
PhylomeDBiA4Q9F4.
TreeFamiTF313087.

Family and domain databases

InterProiIPR004344. TTL/TTLL_fam.
[Graphical view]
PfamiPF03133. TTL. 1 hit.
[Graphical view]
PROSITEiPS51221. TTL. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: A4Q9F4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRSSPEKKP EAEWEADAAA AAAATAAATE SLPAETEKQQ GVDAGAAGDP
60 70 80 90 100
ERLELEEQPK DVGRIPTPTR RHAPEEGEAR VVRRLPPALP LAQPRPAARA
110 120 130 140 150
LSQLVKARGR SRSRVYRRSA GSMRPVTVDS SKARTSLDAL KISLRQLRWK
160 170 180 190 200
EFPFGRRLPC DIYWHGVSFR DSDILSGQVN KFPGMTEMVR KVTLSRALRI
210 220 230 240 250
MQNLFPEEYN FYPRSWILPE EFQLFVSQVQ TVKEGDPSWK PTFIVKPDSG
260 270 280 290 300
CQGDGIYLIK DPCDGRLTGT LHNRPAVVQE YIRKPLLIDK LKFDIRLYVL
310 320 330 340 350
LKSLDPLEIY IAKDGLSRFC TEPYQEPNPQ NLHHVFMHLT NYSLNIHSGK
360 370 380 390 400
FVHSDSASTG SKRTFSSILC RLSSKGVDIK KVWSDIISLV IKTVIALTPE
410 420 430 440 450
LKVFYQSDIP TGRPGPTCFQ ILGFDILLMK NLKPMLLEVN ANPSMRIEHE
460 470 480 490 500
YELSPGVFEN IPSLVDEEVK VAVIRDTLRL MDPLKKKKEI HFPDIYMDRK
510 520 530 540 550
HRIPPVSDRM SSWKHKGSSL SIVRSQQMEK SFTSKEDLNC DPTGGDSEPN
560 570 580 590 600
PEAHLPSICL KQVFPKYAKQ FNYLRLVDRM ANLFIRFLGI KGTMKLGPTG
610 620 630 640 650
FRTFIRNCKL SSSSLSMAAV DILYIDITRR WNSVTVDQRD SGMCLQAFVE
660 670 680 690 700
AFFFLAQRKF KLQPLHEQVA SLIDLCEYHL SVLDEKRLLC HRGRPLQRNP
710 720
PQMNRPEHSA TGSSAPRVIG ASKLSQS
Length:727
Mass (Da):82,361
Last modified:May 15, 2007 - v1
Checksum:i661A7FB585BB9EDB
GO
Isoform 21 Publication (identifier: A4Q9F4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     491-524: HFPDIYMDRKHRIPPVSDRMSSWKHKGSSLSIVR → Q

Note: No experimental confirmation available.Curated
Show »
Length:694
Mass (Da):78,443
Checksum:iE7AE9D0F43EC266F
GO
Isoform 31 Publication (identifier: A4Q9F4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-281: Missing.
     491-524: HFPDIYMDRKHRIPPVSDRMSSWKHKGSSLSIVR → Q

Note: No experimental confirmation available.Curated
Show »
Length:622
Mass (Da):70,247
Checksum:i1D7C35BAD82ACF25
GO

Sequence cautioni

The sequence BAB30318 differs from that shown. Reason: Frameshift at position 119. Curated
The sequence BAB30318 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB30318 differs from that shown. Reason: Erroneous termination at position 304. Translated as Leu.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti110 – 1101R → G in BAB30318 (PubMed:16141072).Curated
Sequence conflicti113 – 1131S → G in BAB30318 (PubMed:16141072).Curated
Sequence conflicti119 – 1191S → D in BAB30318 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei210 – 28172Missing in isoform 3. 1 PublicationVSP_052718Add
BLAST
Alternative sequencei491 – 52434HFPDI…LSIVR → Q in isoform 2 and isoform 3. 2 PublicationsVSP_052719Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM690755 mRNA. Translation: CAM84332.1.
AK016577 mRNA. Translation: BAB30318.1. Sequence problems.
BC115858 mRNA. Translation: AAI15859.1.
CCDSiCCDS50579.1. [A4Q9F4-1]
RefSeqiNP_084050.1. NM_029774.2. [A4Q9F4-1]
UniGeneiMm.21591.
Mm.482520.

Genome annotation databases

EnsembliENSMUST00000028248; ENSMUSP00000028248; ENSMUSG00000026885. [A4Q9F4-1]
ENSMUST00000112976; ENSMUSP00000108600; ENSMUSG00000026885. [A4Q9F4-2]
GeneIDi74410.
KEGGimmu:74410.
UCSCiuc008jkz.3. mouse. [A4Q9F4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM690755 mRNA. Translation: CAM84332.1.
AK016577 mRNA. Translation: BAB30318.1. Sequence problems.
BC115858 mRNA. Translation: AAI15859.1.
CCDSiCCDS50579.1. [A4Q9F4-1]
RefSeqiNP_084050.1. NM_029774.2. [A4Q9F4-1]
UniGeneiMm.21591.
Mm.482520.

3D structure databases

ProteinModelPortaliA4Q9F4.
SMRiA4Q9F4. Positions 178-466.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiA4Q9F4.

Proteomic databases

PaxDbiA4Q9F4.
PRIDEiA4Q9F4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028248; ENSMUSP00000028248; ENSMUSG00000026885. [A4Q9F4-1]
ENSMUST00000112976; ENSMUSP00000108600; ENSMUSG00000026885. [A4Q9F4-2]
GeneIDi74410.
KEGGimmu:74410.
UCSCiuc008jkz.3. mouse. [A4Q9F4-1]

Organism-specific databases

CTDi158135.
MGIiMGI:1921660. Ttll11.

Phylogenomic databases

eggNOGiKOG2158. Eukaryota.
ENOG410XNWC. LUCA.
GeneTreeiENSGT00760000118951.
HOGENOMiHOG000001576.
HOVERGENiHBG108615.
InParanoidiA4Q9F4.
KOiK16604.
OMAiACDIYWH.
OrthoDBiEOG091G039J.
PhylomeDBiA4Q9F4.
TreeFamiTF313087.

Miscellaneous databases

PROiA4Q9F4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026885.
CleanExiMM_TTLL11.
ExpressionAtlasiA4Q9F4. baseline and differential.
GenevisibleiA4Q9F4. MM.

Family and domain databases

InterProiIPR004344. TTL/TTLL_fam.
[Graphical view]
PfamiPF03133. TTL. 1 hit.
[Graphical view]
PROSITEiPS51221. TTL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTTL11_MOUSE
AccessioniPrimary (citable) accession number: A4Q9F4
Secondary accession number(s): Q1LZJ9, Q9D4E7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 15, 2007
Last modified: September 7, 2016
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.