Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin monoglycylase TTLL3

Gene

Ttll3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. Involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. Not involved in elongation step of the polyglycylation reaction.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei527 – 5271ATPBy similarity
Binding sitei529 – 5291ATPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi514 – 5174ATP bindingBy similarity

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein-glycine ligase activity Source: UniProtKB
  • protein-glycine ligase activity, initiating Source: UniProtKB

GO - Biological processi

  • axoneme assembly Source: UniProtKB
  • cilium assembly Source: UniProtKB
  • protein polyglycylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin monoglycylase TTLL3 (EC:6.3.2.-)
Alternative name(s):
Tubulin--tyrosine ligase-like protein 3
Gene namesi
Name:Ttll3Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2141418. Ttll3.

Subcellular locationi

GO - Cellular componenti

  • axoneme Source: UniProtKB
  • cilium Source: UniProtKB
  • cytoplasm Source: UniProtKB-KW
  • microtubule Source: UniProtKB-KW
  • microtubule cytoskeleton Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 927927Tubulin monoglycylase TTLL3PRO_0000326159Add
BLAST

Proteomic databases

PaxDbiA4Q9E5.
PRIDEiA4Q9E5.

PTM databases

PhosphoSiteiA4Q9E5.

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain and testis.1 Publication

Gene expression databases

BgeeiA4Q9E5.
CleanExiMM_TTLL3.
ExpressionAtlasiA4Q9E5. baseline and differential.
GenevisibleiA4Q9E5. MM.

Interactioni

Protein-protein interaction databases

IntActiA4Q9E5. 1 interaction.
STRINGi10090.ENSMUSP00000032414.

Structurei

3D structure databases

ProteinModelPortaliA4Q9E5.
SMRiA4Q9E5. Positions 482-683.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini345 – 702358TTLPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 TTL domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2157. Eukaryota.
ENOG410XQDM. LUCA.
GeneTreeiENSGT00760000118951.
HOGENOMiHOG000154711.
HOVERGENiHBG069401.
InParanoidiA4Q9E5.
KOiK16608.
OrthoDBiEOG7RBZ7P.
PhylomeDBiA4Q9E5.
TreeFamiTF313087.

Family and domain databases

InterProiIPR004344. TTL/TTLL_fam.
[Graphical view]
PfamiPF03133. TTL. 1 hit.
[Graphical view]
PROSITEiPS51221. TTL. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: A4Q9E5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGVSSALLL SAGQLGPGAA WYRQEGSSEC SWLRRSQPSE LRTNFSSRWP
60 70 80 90 100
WPRNSESRRS ERLQWPGPAS AKPEVASCGD SRRDYSSLPA RHLSSARESS
110 120 130 140 150
MPGALGTVNP QPVRTLVPPT LDEPLPDALR PPDDSLLLWR GLTKGPNHMG
160 170 180 190 200
RLRNAKIHVE RAVKQKKIFM IHGRYPVIRC LLRQRGWVEK KMVHPPGTAL
210 220 230 240 250
PAPQKDLDSS MLGDSDATED EDEEENEMFR ESQLLDLDGF LEFDDLDGIH
260 270 280 290 300
ALMSRMVRNE TPYLIWTTRR DVLDCRFLSK DQMINHYARA GSFTTKVGLC
310 320 330 340 350
LNLRNLPWFD EADADSFFPR CYRLGAEDDK KAFIEDFWLT AARNVLKLVV
360 370 380 390 400
KLEEKSQSIS IQAREEEAPE DTQPKKQEKK LVTVSSDFVD EALSACQEHL
410 420 430 440 450
SSIAHKDIDK DPNSPLYLSP DDWSQFLQRY YQIVHEGAEL RYLEVQVQRC
460 470 480 490 500
EDILQQLQNV VPQLDMEGDR NIWIVKPGAK SRGRGIMCMN RLDEMLKLVD
510 520 530 540 550
CNPMLMKDGK WIVQKYIERP LLIFGTKFDL RQWFLVTDWN PLTVWFYRDS
560 570 580 590 600
YIRFSTQPFS LKNLDNSVHL CNNSIQRHLE ASCHRHPMLP PDNMWSSQRF
610 620 630 640 650
QAHLQEVDAP KAWSSVIVPG MKAAVIHALQ TSQDNVQCRK ASFELYGADF
660 670 680 690 700
VFGEDFQPWL IEINASPTMA PSTAVTARLC AGVQADTLRV VIDRRLDRSC
710 720 730 740 750
DTGAFELIYK QPAVEVPQYV GIRLLVEGST IKKPVPVGHR RTGVRSSLPH
760 770 780 790 800
LLTQQGSGES KDSGSPTHRS ASRKNARAES LEHTEKPEPA AVASVSGKGK
810 820 830 840 850
KAPFHFPSLH SKAWLPSPRV HRPQGRVLRL QHDQLVGSKA LSTTGKALMT
860 870 880 890 900
LPTAKVLMSF PPHPDLKLAP SMLKPGKVGF ELCCTTWRVV LSGGIGEEGH
910 920
RQRAAPRPSS APGKGLSSTE PCSKTET
Length:927
Mass (Da):104,428
Last modified:May 15, 2007 - v1
Checksum:i9E04C14CABD8B311
GO
Isoform 22 Publications (identifier: A4Q9E5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-148: Missing.
     335-435: EDFWLTAARN...FLQRYYQIVH → GKGTPIPGLA...QSKFLFQHGF
     436-927: Missing.

Show »
Length:287
Mass (Da):32,309
Checksum:iECEAC50CA524BB46
GO
Isoform 31 Publication (identifier: A4Q9E5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-253: EENEMFRESQLLDLDGFLEFDDLDGIHALM → MDTSSPFYAAGQGEASPPSLPVSISSPSLQ

Note: No experimental confirmation available.Curated
Show »
Length:704
Mass (Da):79,080
Checksum:i3FAD889C1DB5CF7D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti214 – 2141D → N in BAC26459 (PubMed:16141072).Curated
Isoform 22 Publications (identifier: A4Q9E5-2)
Sequence conflicti241 – 2411P → Q in BAC26459 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 223223Missing in isoform 3. 1 PublicationVSP_052722Add
BLAST
Alternative sequencei1 – 148148Missing in isoform 2. 2 PublicationsVSP_052724Add
BLAST
Alternative sequencei224 – 25330EENEM…IHALM → MDTSSPFYAAGQGEASPPSL PVSISSPSLQ in isoform 3. 1 PublicationVSP_052723Add
BLAST
Alternative sequencei335 – 435101EDFWL…YQIVH → GKGTPIPGLAPSCCLSHRGK EQASPCGLCNPSPFLLPMGL PFISQPWHSEKPREPGLYPV AGSRGGWVGSVWSLDKLLAG PGSTKGNGSLRQSKFLFQHG F in isoform 2. 2 PublicationsVSP_052725Add
BLAST
Alternative sequencei436 – 927492Missing in isoform 2. 2 PublicationsVSP_052726Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM690746 mRNA. Translation: CAM84323.1.
AK029462 mRNA. Translation: BAC26459.1.
AK080321 mRNA. Translation: BAC37878.1.
BC021404 mRNA. Translation: AAH21404.1.
CCDSiCCDS39593.2. [A4Q9E5-1]
RefSeqiNP_001136204.1. NM_001142732.1. [A4Q9E5-2]
NP_598684.4. NM_133923.6. [A4Q9E5-1]
UniGeneiMm.388573.

Genome annotation databases

EnsembliENSMUST00000032414; ENSMUSP00000032414; ENSMUSG00000030276. [A4Q9E5-1]
ENSMUST00000204026; ENSMUSP00000145049; ENSMUSG00000030276. [A4Q9E5-2]
GeneIDi101100.
KEGGimmu:101100.
UCSCiuc009dfu.2. mouse. [A4Q9E5-2]
uc009dfv.2. mouse. [A4Q9E5-1]
uc009dfw.1. mouse. [A4Q9E5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM690746 mRNA. Translation: CAM84323.1.
AK029462 mRNA. Translation: BAC26459.1.
AK080321 mRNA. Translation: BAC37878.1.
BC021404 mRNA. Translation: AAH21404.1.
CCDSiCCDS39593.2. [A4Q9E5-1]
RefSeqiNP_001136204.1. NM_001142732.1. [A4Q9E5-2]
NP_598684.4. NM_133923.6. [A4Q9E5-1]
UniGeneiMm.388573.

3D structure databases

ProteinModelPortaliA4Q9E5.
SMRiA4Q9E5. Positions 482-683.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA4Q9E5. 1 interaction.
STRINGi10090.ENSMUSP00000032414.

PTM databases

PhosphoSiteiA4Q9E5.

Proteomic databases

PaxDbiA4Q9E5.
PRIDEiA4Q9E5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032414; ENSMUSP00000032414; ENSMUSG00000030276. [A4Q9E5-1]
ENSMUST00000204026; ENSMUSP00000145049; ENSMUSG00000030276. [A4Q9E5-2]
GeneIDi101100.
KEGGimmu:101100.
UCSCiuc009dfu.2. mouse. [A4Q9E5-2]
uc009dfv.2. mouse. [A4Q9E5-1]
uc009dfw.1. mouse. [A4Q9E5-3]

Organism-specific databases

CTDi26140.
MGIiMGI:2141418. Ttll3.

Phylogenomic databases

eggNOGiKOG2157. Eukaryota.
ENOG410XQDM. LUCA.
GeneTreeiENSGT00760000118951.
HOGENOMiHOG000154711.
HOVERGENiHBG069401.
InParanoidiA4Q9E5.
KOiK16608.
OrthoDBiEOG7RBZ7P.
PhylomeDBiA4Q9E5.
TreeFamiTF313087.

Miscellaneous databases

ChiTaRSiTtll3. mouse.
PROiA4Q9E5.
SOURCEiSearch...

Gene expression databases

BgeeiA4Q9E5.
CleanExiMM_TTLL3.
ExpressionAtlasiA4Q9E5. baseline and differential.
GenevisibleiA4Q9E5. MM.

Family and domain databases

InterProiIPR004344. TTL/TTLL_fam.
[Graphical view]
PfamiPF03133. TTL. 1 hit.
[Graphical view]
PROSITEiPS51221. TTL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A targeted multienzyme mechanism for selective microtubule polyglutamylation."
    van Dijk J., Rogowski K., Miro J., Lacroix B., Edde B., Janke C.
    Mol. Cell 26:437-448(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Strain: C57BL/6JImported.
    Tissue: TestisImported.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6JImported.
    Tissue: HeadImported and ThymusImported.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: Czech IIImported.
    Tissue: Mammary tumorImported.
  4. "Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation."
    Rogowski K., Juge F., van Dijk J., Wloga D., Strub J.-M., Levilliers N., Thomas D., Bre M.-H., Van Dorsselaer A., Gaertig J., Janke C.
    Cell 137:1076-1087(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiTTLL3_MOUSE
AccessioniPrimary (citable) accession number: A4Q9E5
Secondary accession number(s): Q8BV51, Q8C0Y7, Q8VDS2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 15, 2007
Last modified: June 8, 2016
This is version 74 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.