A4FU49 (SH321_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 58.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH3 domain-containing protein 21 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 640 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 1 SH3 domain. |
| Sequence caution | The sequence AAI01677.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence AAI01679.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence BAB15504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB71191.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence CAH71860.2 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAX07375.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAX07376.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil SH3 domain |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A4FU49-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. Gene prediction based on EST data and similarity to mouse and macaca fascicularis orthologs. | ||||||
| Isoform 2 (identifier: A4FU49-3) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MIKEIEDGWWLGKKNGQLGAFPSNFVELLDSGPPS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: A4FU49-4) The sequence of this isoform differs from the canonical sequence as follows: 1-96: MVQSELQLQP...RRGDVVKVLS → MIKEIEDGWW...SVSPGPQRPP 173-179: TSRTPSR → RKSTAAR 180-640: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: A4FU49-5) The sequence of this isoform differs from the canonical sequence as follows: 191-232: PNGGFQSGGS...EEHSSPVKAP → GRAQQPGKGP...RPQLQEDPGS 233-640: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 5 (identifier: A4FU49-6) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MEVLVLAGYR...VELLDSGPPS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 640 | 640 | SH3 domain-containing protein 21 | PRO_0000337129 | |||||
Regions | |||||||||
| Domain | 65 – 126 | 62 | SH3 | ||||||
| Coiled coil | 572 – 626 | 55 | Potential | ||||||
| Compositional bias | 123 – 126 | 4 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 189 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 96 | 96 | MVQSE…VKVLS → MIKEIEDGWWLGKRNGQLGA FPSNFVELLDSGPPSLGNPD MPSVSPGPQRPP in isoform 3. | VSP_040923 | |||||
| Alternative sequence | 1 – 30 | 30 | MVQSE…NDKGG → MIKEIEDGWWLGKKNGQLGA FPSNFVELLDSGPPS in isoform 2. | VSP_040924 | |||||
| Alternative sequence | 1 – 30 | 30 | MVQSE…NDKGG → MEVLVLAGYRAQKEDELSLA PGDVVRQVRWVPARGWLRGE FGGRYGLFPERLVQEIPETL RGSGEARRPRCARRRGHPAK HPRPQRWCKVNFSYSPEQAD ELKLQAGEIVEMIKEIEDGW WLGKKNGQLGAFPSNFVELL DSGPPS in isoform 5. | VSP_045936 | |||||
| Alternative sequence | 173 – 179 | 7 | TSRTPSR → RKSTAAR in isoform 3. | VSP_040925 | |||||
| Alternative sequence | 180 – 640 | 461 | Missing in isoform 3. | VSP_040926 | |||||
| Alternative sequence | 191 – 232 | 42 | PNGGF…PVKAP → GRAQQPGKGPLCEENPHAGQ DCHPREAPSSRERPQLQEDP GS in isoform 4. | VSP_040927 | |||||
| Alternative sequence | 233 – 640 | 408 | Missing in isoform 4. | VSP_040928 | |||||
| Natural variant | 217 | 1 | S → A. Corresponds to variant rs12121759 [ dbSNP | Ensembl ]. | VAR_043619 | |||||
| Natural variant | 455 | 1 | A → S. Corresponds to variant rs12121759 [ dbSNP | Ensembl ]. | VAR_056763 | |||||
Experimental info | |||||||||
| Sequence conflict | 327 | 1 | K → E in BAB71191. Ref.1 | ||||||
| Sequence conflict | 413 | 1 | E → G in BAB71191. Ref.1 | ||||||
| Sequence conflict | 541 – 542 | 2 | TR → NS in BAB71191. Ref.1 | ||||||
| Sequence conflict | 582 | 1 | E → G in BAB71191. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK026591 mRNA. Translation: BAB15504.1. Different initiation. AK297015 mRNA. Translation: BAG59548.1. AK056459 mRNA. Translation: BAB71191.1. Sequence problems. AL591845 Genomic DNA. Translation: CAH71860.2. Sequence problems. CH471059 Genomic DNA. Translation: EAX07374.1. CH471059 Genomic DNA. Translation: EAX07375.1. Sequence problems. CH471059 Genomic DNA. Translation: EAX07376.1. Sequence problems. BC036763 mRNA. Translation: AAH36763.1. BC048273 mRNA. Translation: AAH48273.1. BC101676 mRNA. Translation: AAI01677.1. Sequence problems. BC101678 mRNA. Translation: AAI01679.1. Sequence problems. |
| IPI | IPI00395985. IPI00893644. IPI01008835. IPI01008859. |
| RefSeq | NP_001156002.1. NM_001162530.1. NP_078952.4. NM_024676.4. |
| UniGene | Hs.524496. |
3D structure databases | |
| ProteinModelPortal | A4FU49. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | A4FU49. 1 interaction. |
| STRING | 9606.ENSP00000321936. |
PTM databases | |
| PhosphoSite | A4FU49. |
Proteomic databases | |
| PaxDb | A4FU49. |
| PRIDE | A4FU49. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000312808; ENSP00000321936; ENSG00000214193. ENST00000426732; ENSP00000408613; ENSG00000214193. ENST00000453908; ENSP00000403476; ENSG00000214193. ENST00000505871; ENSP00000421294; ENSG00000214193. |
| GeneID | 79729. |
| KEGG | hsa:79729. |
| UCSC | uc009vuz.1. human. uc010oia.1. human. |
Organism-specific databases | |
| CTD | 79729. |
| GeneCards | GC01P036772. |
| H-InvDB | HIX0199850. |
| HGNC | HGNC:26236. SH3D21. |
| HPA | HPA042212. HPA042456. |
| neXtProt | NX_A4FU49. |
| PharmGKB | PA142672497. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG119357. |
| HOVERGEN | HBG107554. |
| InParanoid | A4FU49. |
| OrthoDB | EOG4C87S3. |
Gene expression databases | |
| ArrayExpress | A4FU49. |
| Bgee | A4FU49. |
| CleanEx | HS_C1orf113. |
| Genevestigator | A4FU49. |
Family and domain databases | |
| InterPro | IPR011511. SH3_2. IPR001452. SH3_domain. IPR013315. Spectrin_alpha_SH3. [Graphical view] |
| Pfam | PF07653. SH3_2. 1 hit. [Graphical view] |
| PRINTS | PR00452. SH3DOMAIN. PR01887. SPECTRNALPHA. |
| SMART | SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 1 hit. |
| PROSITE | PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SH3D21. human. |
| GenomeRNAi | 79729. |
| NextBio | 35535373. |
Entry information
| Entry name | SH321_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A4FU49 Secondary accession number(s): B4DLI6 Q9H5W5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
