Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A4FU49

- SH321_HUMAN

UniProt

A4FU49 - SH321_HUMAN

Protein

SH3 domain-containing protein 21

Gene

SH3D21

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 69 (01 Oct 2014)
      Sequence version 2 (20 May 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SH3 domain-containing protein 21
    Gene namesi
    Name:SH3D21
    Synonyms:C1orf113
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:26236. SH3D21.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672497.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 640640SH3 domain-containing protein 21PRO_0000337129Add
    BLAST

    Proteomic databases

    PaxDbiA4FU49.
    PRIDEiA4FU49.

    PTM databases

    PhosphoSiteiA4FU49.

    Expressioni

    Gene expression databases

    ArrayExpressiA4FU49.
    BgeeiA4FU49.
    CleanExiHS_C1orf113.
    GenevestigatoriA4FU49.

    Organism-specific databases

    HPAiHPA042212.
    HPA042456.

    Interactioni

    Protein-protein interaction databases

    IntActiA4FU49. 1 interaction.
    STRINGi9606.ENSP00000321936.

    Structurei

    3D structure databases

    ProteinModelPortaliA4FU49.
    SMRiA4FU49. Positions 71-121.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini65 – 12662SH3PROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili572 – 62655Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi123 – 1264Poly-Pro

    Sequence similaritiesi

    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, SH3 domain

    Phylogenomic databases

    eggNOGiNOG119357.
    HOVERGENiHBG107554.
    InParanoidiA4FU49.
    OMAiFAQKTRP.
    OrthoDBiEOG7P8P7T.
    PhylomeDBiA4FU49.
    TreeFamiTF351294.

    Family and domain databases

    InterProiIPR011511. SH3_2.
    IPR001452. SH3_domain.
    IPR013315. Spectrin_alpha_SH3.
    [Graphical view]
    PfamiPF07653. SH3_2. 1 hit.
    [Graphical view]
    PRINTSiPR00452. SH3DOMAIN.
    PR01887. SPECTRNALPHA.
    SMARTiSM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    PROSITEiPS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A4FU49-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVQSELQLQP RAGGRAEAAS WGDRGNDKGG LGNPDMPSVS PGPQRPPKLS    50
    SLAYDSPPDY LQTVSHPEVY RVLFDYQPEA PDELALRRGD VVKVLSKTTE 100
    DKGWWEGECQ GRRGVFPDNF VLPPPPIKKL VPRKVVSRES APIKEPKKLM 150
    PKTSLPTVKK LATATTGPSK AKTSRTPSRD SQKLTSRDSG PNGGFQSGGS 200
    YHPGRKRSKT QTPQQRSVSS QEEEHSSPVK APSVKRTPMP DKTATPERPP 250
    APENAPSSKK IPAPDKVPSP EKTLTLGDKA SIPGNSTSGK IPAPDKVPTP 300
    EKMVTPEDKA SIPENSIIPE ETLTVDKPST PERVFSVEES PALEAPPMDK 350
    VPNPKMAPLG DEAPTLEKVL TPELSEEEVS TRDDIQFHHF SSEEALQKVK 400
    YFVAKEDPSS QEEAHTPEAP PPQPPSSERC LGEMKCTLVR GDSSPRQAEL 450
    KSGPASRPAL EKPHPHEEAT TLPEEAPSND ERTPEEEAPP NEQRPLREEV 500
    LPKEGVASKE EVTLKEELPP KEEVAPKEEV PPIERAFAQK TRPIKPPPDS 550
    QETLALPSLV PQNYTENKNE GVDVTSLRGE VESLRRALEL MEVQLERKLT 600
    DIWEELKSEK EQRRRLEVQV MQGTQKSQTP RVIHTQTQTY 640

    Note: No experimental confirmation available. Gene prediction based on EST data and similarity to mouse and macaca fascicularis orthologs.

    Length:640
    Mass (Da):70,519
    Last modified:May 20, 2008 - v2
    Checksum:i59992262EE553FA3
    GO
    Isoform 2 (identifier: A4FU49-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MIKEIEDGWWLGKKNGQLGAFPSNFVELLDSGPPS

    Note: No experimental confirmation available.

    Show »
    Length:645
    Mass (Da):71,238
    Checksum:iD7FA6E6957E2036C
    GO
    Isoform 3 (identifier: A4FU49-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-96: MVQSELQLQP...RRGDVVKVLS → MIKEIEDGWW...SVSPGPQRPP
         173-179: TSRTPSR → RKSTAAR
         180-640: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:135
    Mass (Da):14,779
    Checksum:i4790D889DFD47599
    GO
    Isoform 4 (identifier: A4FU49-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         191-232: PNGGFQSGGS...EEHSSPVKAP → GRAQQPGKGP...RPQLQEDPGS
         233-640: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:232
    Mass (Da):25,313
    Checksum:i0DA164A88407EF27
    GO
    Isoform 5 (identifier: A4FU49-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MEVLVLAGYR...VELLDSGPPS

    Show »
    Length:756
    Mass (Da):83,970
    Checksum:i1B6BA2463B701102
    GO

    Sequence cautioni

    The sequence BAB15504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAH71860.2 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence EAX07375.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence EAX07376.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti327 – 3271K → E in BAB71191. (PubMed:14702039)Curated
    Sequence conflicti413 – 4131E → G in BAB71191. (PubMed:14702039)Curated
    Sequence conflicti541 – 5422TR → NS in BAB71191. (PubMed:14702039)Curated
    Sequence conflicti582 – 5821E → G in BAB71191. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti217 – 2171S → A.
    Corresponds to variant rs12121759 [ dbSNP | Ensembl ].
    VAR_043619
    Natural varianti455 – 4551A → S.
    Corresponds to variant rs12121759 [ dbSNP | Ensembl ].
    VAR_056763

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9696MVQSE…VKVLS → MIKEIEDGWWLGKRNGQLGA FPSNFVELLDSGPPSLGNPD MPSVSPGPQRPP in isoform 3. 2 PublicationsVSP_040923Add
    BLAST
    Alternative sequencei1 – 3030MVQSE…NDKGG → MIKEIEDGWWLGKKNGQLGA FPSNFVELLDSGPPS in isoform 2. 2 PublicationsVSP_040924Add
    BLAST
    Alternative sequencei1 – 3030MVQSE…NDKGG → MEVLVLAGYRAQKEDELSLA PGDVVRQVRWVPARGWLRGE FGGRYGLFPERLVQEIPETL RGSGEARRPRCARRRGHPAK HPRPQRWCKVNFSYSPEQAD ELKLQAGEIVEMIKEIEDGW WLGKKNGQLGAFPSNFVELL DSGPPS in isoform 5. CuratedVSP_045936Add
    BLAST
    Alternative sequencei173 – 1797TSRTPSR → RKSTAAR in isoform 3. 2 PublicationsVSP_040925
    Alternative sequencei180 – 640461Missing in isoform 3. 2 PublicationsVSP_040926Add
    BLAST
    Alternative sequencei191 – 23242PNGGF…PVKAP → GRAQQPGKGPLCEENPHAGQ DCHPREAPSSRERPQLQEDP GS in isoform 4. 1 PublicationVSP_040927Add
    BLAST
    Alternative sequencei233 – 640408Missing in isoform 4. 1 PublicationVSP_040928Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026591 mRNA. Translation: BAB15504.1. Different initiation.
    AK297015 mRNA. Translation: BAG59548.1.
    AK056459 mRNA. Translation: BAB71191.1. Sequence problems.
    AL591845 Genomic DNA. Translation: CAH71860.2. Sequence problems.
    CH471059 Genomic DNA. Translation: EAX07374.1.
    CH471059 Genomic DNA. Translation: EAX07375.1. Sequence problems.
    CH471059 Genomic DNA. Translation: EAX07376.1. Sequence problems.
    BC036763 mRNA. Translation: AAH36763.1.
    BC048273 mRNA. Translation: AAH48273.1.
    BC101676 mRNA. Translation: AAI01677.1. Sequence problems.
    BC101678 mRNA. Translation: AAI01679.1. Sequence problems.
    CCDSiCCDS30674.2. [A4FU49-3]
    CCDS53298.1. [A4FU49-6]
    RefSeqiNP_001156002.1. NM_001162530.1. [A4FU49-6]
    NP_078952.4. NM_024676.4. [A4FU49-3]
    UniGeneiHs.524496.

    Genome annotation databases

    EnsembliENST00000453908; ENSP00000403476; ENSG00000214193. [A4FU49-6]
    ENST00000505871; ENSP00000421294; ENSG00000214193. [A4FU49-3]
    GeneIDi79729.
    KEGGihsa:79729.
    UCSCiuc009vuz.1. human. [A4FU49-1]
    uc010oia.1. human.
    uc010oib.1. human. [A4FU49-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026591 mRNA. Translation: BAB15504.1 . Different initiation.
    AK297015 mRNA. Translation: BAG59548.1 .
    AK056459 mRNA. Translation: BAB71191.1 . Sequence problems.
    AL591845 Genomic DNA. Translation: CAH71860.2 . Sequence problems.
    CH471059 Genomic DNA. Translation: EAX07374.1 .
    CH471059 Genomic DNA. Translation: EAX07375.1 . Sequence problems.
    CH471059 Genomic DNA. Translation: EAX07376.1 . Sequence problems.
    BC036763 mRNA. Translation: AAH36763.1 .
    BC048273 mRNA. Translation: AAH48273.1 .
    BC101676 mRNA. Translation: AAI01677.1 . Sequence problems.
    BC101678 mRNA. Translation: AAI01679.1 . Sequence problems.
    CCDSi CCDS30674.2. [A4FU49-3 ]
    CCDS53298.1. [A4FU49-6 ]
    RefSeqi NP_001156002.1. NM_001162530.1. [A4FU49-6 ]
    NP_078952.4. NM_024676.4. [A4FU49-3 ]
    UniGenei Hs.524496.

    3D structure databases

    ProteinModelPortali A4FU49.
    SMRi A4FU49. Positions 71-121.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi A4FU49. 1 interaction.
    STRINGi 9606.ENSP00000321936.

    PTM databases

    PhosphoSitei A4FU49.

    Proteomic databases

    PaxDbi A4FU49.
    PRIDEi A4FU49.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000453908 ; ENSP00000403476 ; ENSG00000214193 . [A4FU49-6 ]
    ENST00000505871 ; ENSP00000421294 ; ENSG00000214193 . [A4FU49-3 ]
    GeneIDi 79729.
    KEGGi hsa:79729.
    UCSCi uc009vuz.1. human. [A4FU49-1 ]
    uc010oia.1. human.
    uc010oib.1. human. [A4FU49-3 ]

    Organism-specific databases

    CTDi 79729.
    GeneCardsi GC01P036772.
    H-InvDB HIX0199850.
    HGNCi HGNC:26236. SH3D21.
    HPAi HPA042212.
    HPA042456.
    neXtProti NX_A4FU49.
    PharmGKBi PA142672497.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG119357.
    HOVERGENi HBG107554.
    InParanoidi A4FU49.
    OMAi FAQKTRP.
    OrthoDBi EOG7P8P7T.
    PhylomeDBi A4FU49.
    TreeFami TF351294.

    Miscellaneous databases

    ChiTaRSi SH3D21. human.
    GenomeRNAii 79729.
    NextBioi 35535373.
    PROi A4FU49.

    Gene expression databases

    ArrayExpressi A4FU49.
    Bgeei A4FU49.
    CleanExi HS_C1orf113.
    Genevestigatori A4FU49.

    Family and domain databases

    InterProi IPR011511. SH3_2.
    IPR001452. SH3_domain.
    IPR013315. Spectrin_alpha_SH3.
    [Graphical view ]
    Pfami PF07653. SH3_2. 1 hit.
    [Graphical view ]
    PRINTSi PR00452. SH3DOMAIN.
    PR01887. SPECTRNALPHA.
    SMARTi SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    PROSITEi PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Signet-ring cell carcinoma, Teratocarcinoma and Umbilical cord blood.
    2. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 162-640 (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 379-640 (ISOFORM 2).
      Tissue: Brain, Liver and Ovary.

    Entry informationi

    Entry nameiSH321_HUMAN
    AccessioniPrimary (citable) accession number: A4FU49
    Secondary accession number(s): B4DLI6
    , D3DPS6, J3KQM5, Q5VTK7, Q86XZ6, Q8N445, Q96DN4, Q9H5W5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 20, 2008
    Last sequence update: May 20, 2008
    Last modified: October 1, 2014
    This is version 69 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3