Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative postmeiotic segregation increased 2-like protein 1

Gene

PMS2P1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Protein uncertaini

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
Putative postmeiotic segregation increased 2-like protein 1
Alternative name(s):
PMS2-related protein 2
Postmeiotic segregation increased 2-like protein 13
Postmeiotic segregation increased 2-like protein 6
Postmeiotic segregation increased 2-like protein 8
Postmeiotic segregation increased protein 3
Short name:
hPMS3
Postmeiotic segregation increased protein 8
Putative postmeiotic segregation increased 2 pseudogene 1
Gene namesi
Name:PMS2P1
Synonyms:PMS2L1, PMS2L13, PMS2L6, PMS2L8, PMS3, PMS8, PMSR2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:9123. PMS2P1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 440440Putative postmeiotic segregation increased 2-like protein 1PRO_0000311098Add
BLAST

Proteomic databases

MaxQBiA4D2B8.
PRIDEiA4D2B8.

PTM databases

iPTMnetiA4D2B8.
PhosphoSiteiA4D2B8.

Expressioni

Tissue specificityi

Highly expressed in kidney, spleen, adrenal gland, ovary and cerebellum and to a lower extent in liver, esophagus, stomach, duodenum, colon, bladder, uterus, lung, pancreas and cerebrum. Not expressed in heart.1 Publication

Organism-specific databases

HPAiHPA043839.

Structurei

3D structure databases

ProteinModelPortaliA4D2B8.
SMRiA4D2B8. Positions 229-382.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini230 – 364135Histidine kinaseAdd
BLAST

Sequence similaritiesi

Contains 1 histidine kinase domain.Curated

Phylogenomic databases

HOVERGENiHBG108273.
InParanoidiA4D2B8.
PhylomeDBiA4D2B8.

Family and domain databases

Gene3Di3.30.565.10. 1 hit.
InterProiIPR014762. DNA_mismatch_repair_CS.
IPR003594. HATPase_C.
[Graphical view]
SUPFAMiSSF55874. SSF55874. 1 hit.
PROSITEiPS00058. DNA_MISMATCH_REPAIR_1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A4D2B8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVTMCGGHRP ENFLHQVLTE FGEELAGEGK SEVGGGAPRS YLQVASAECW
60 70 80 90 100
AAAPAVHVGE PVHAGGLHTE RGADPVIGLY LVHRGGACQT PTVGNRQTPT
110 120 130 140 150
LGIHARPRRR ATTSLLTLLL AFGKNAVRCA LIGPGSLTSR TRPLTEPLGE
160 170 180 190 200
KERREVFFPP RPERVEHNVE SSRWEPRRRG ACGSRGGNFP SPRGGSGVAS
210 220 230 240 250
LERAESSSTE PAKAIKPIDR KSVHQICSGP VVPSLSTAVK ELVENSLDAG
260 270 280 290 300
ATNIDLKLKD YGVDLIEVSG NGCGVEEENF EGLTLKHHTS KIQEFADLPQ
310 320 330 340 350
VETFGFRGEA LSSLCALSDV TISTCHVSAK VGTRLVFDHY GKIIQKTPYP
360 370 380 390 400
HPRGMTVSVK QLFSTLPVHH KEFQRNIKKK RACFPFAFCR DCQFPEASPA
410 420 430 440
MLPVQPAELT PRSTPPHPCS LEDNVITVFS SVKNGPGSSR
Length:440
Mass (Da):47,508
Last modified:April 3, 2007 - v1
Checksum:iC5182F4FBDF5C931
GO
Isoform 2 (identifier: A4D2B8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     380-412: KRACFPFAFCRDCQFPEASPAMLPVQPAELTPR → PPIYSLKHVRGGPELLCKWTHCPEATMLQGSPS
     413-440: Missing.

Note: No experimental confirmation available.
Show »
Length:412
Mass (Da):44,522
Checksum:i076096B40620A2F5
GO
Isoform 3 (identifier: A4D2B8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     380-381: KR → DS
     382-440: Missing.

Note: No experimental confirmation available.
Show »
Length:381
Mass (Da):41,108
Checksum:i03358830E5FDF78D
GO

Sequence cautioni

The sequence AAA97458 differs from that shown.Several conflicts but it is uncertain if it is due to sequencing errors or if this sequence is another copy of this gene.Curated
The sequence AAA97458 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti175 – 1751E → G in BC067809 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei380 – 41233KRACF…ELTPR → PPIYSLKHVRGGPELLCKWT HCPEATMLQGSPS in isoform 2. 1 PublicationVSP_029389Add
BLAST
Alternative sequencei380 – 3812KR → DS in isoform 3. 1 PublicationVSP_038329
Alternative sequencei382 – 44059Missing in isoform 3. 1 PublicationVSP_038330Add
BLAST
Alternative sequencei413 – 44028Missing in isoform 2. 1 PublicationVSP_029390Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U38964 Genomic DNA. Translation: AAA97458.1. Sequence problems.
CH236956 Genomic DNA. Translation: EAL23838.1.
AB017004 mRNA. Translation: BAA74753.1.
CH471091 Genomic DNA. Translation: EAW76560.1.
BC067809 mRNA. No translation available.
BC110395 mRNA. No translation available.
D38435 mRNA. Translation: BAA07470.1.
D38499 mRNA. Translation: BAA07511.1.
PIRiJC2398.
JC2399.
UniGeneiHs.634244.
Hs.661055.
Hs.703626.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U38964 Genomic DNA. Translation: AAA97458.1. Sequence problems.
CH236956 Genomic DNA. Translation: EAL23838.1.
AB017004 mRNA. Translation: BAA74753.1.
CH471091 Genomic DNA. Translation: EAW76560.1.
BC067809 mRNA. No translation available.
BC110395 mRNA. No translation available.
D38435 mRNA. Translation: BAA07470.1.
D38499 mRNA. Translation: BAA07511.1.
PIRiJC2398.
JC2399.
UniGeneiHs.634244.
Hs.661055.
Hs.703626.

3D structure databases

ProteinModelPortaliA4D2B8.
SMRiA4D2B8. Positions 229-382.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiA4D2B8.
PhosphoSiteiA4D2B8.

Proteomic databases

MaxQBiA4D2B8.
PRIDEiA4D2B8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

GeneCardsiPMS2P1.
HGNCiHGNC:9123. PMS2P1.
HPAiHPA043839.
MIMi605038. gene.
neXtProtiNX_A4D2B8.
GenAtlasiSearch...

Phylogenomic databases

HOVERGENiHBG108273.
InParanoidiA4D2B8.
PhylomeDBiA4D2B8.

Miscellaneous databases

ChiTaRSiPMS2P1. human.
PROiA4D2B8.
SOURCEiSearch...

Family and domain databases

Gene3Di3.30.565.10. 1 hit.
InterProiIPR014762. DNA_mismatch_repair_CS.
IPR003594. HATPase_C.
[Graphical view]
SUPFAMiSSF55874. SSF55874. 1 hit.
PROSITEiPS00058. DNA_MISMATCH_REPAIR_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPM2P1_HUMAN
AccessioniPrimary (citable) accession number: A4D2B8
Secondary accession number(s): Q0VGD2
, Q13400, Q16530, Q6NVZ2, Q7KZ90
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: April 3, 2007
Last modified: September 7, 2016
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Encoded by one of the numerous copies of postmeiotic segregation increased 2-like genes scattered in the q11-q22 region of the chromosome 7.

Caution

Could be the product of a pseudogene.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.