SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

A4D1S5

- RAB19_HUMAN

UniProt

A4D1S5 - RAB19_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ras-related protein Rab-19
Gene
RAB19, RAB19B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi24 – 318GTP By similarity
Nucleotide bindingi72 – 765GTP By similarity
Nucleotide bindingi130 – 1334GTP By similarity

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW
Complete GO annotation...

GO - Biological processi

  1. protein transport Source: InterPro
  2. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-19
Gene namesi
Name:RAB19
Synonyms:RAB19B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:19982. RAB19.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400617.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 217217Ras-related protein Rab-19
PRO_0000300459Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi215 – 2151S-geranylgeranyl cysteine By similarity
Modified residuei217 – 2171Cysteine methyl ester By similarity
Lipidationi217 – 2171S-geranylgeranyl cysteine By similarity

Keywords - PTMi

Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiA4D1S5.
PaxDbiA4D1S5.
PRIDEiA4D1S5.

PTM databases

PhosphoSiteiA4D1S5.

Expressioni

Gene expression databases

ArrayExpressiA4D1S5.
BgeeiA4D1S5.
CleanExiHS_RAB19.
GenevestigatoriA4D1S5.

Organism-specific databases

HPAiHPA051077.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000275874.

Structurei

3D structure databases

ProteinModelPortaliA4D1S5.
SMRiA4D1S5. Positions 14-183.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi46 – 549Effector region By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1100.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
KOiK17047.
OMAiNKCDLWE.
PhylomeDBiA4D1S5.
TreeFamiTF300097.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: A4D1S5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MHFSSSARAA DENFDYLFKI ILIGDSNVGK TCVVQHFKSG VYTETQQNTI    50
GVDFTVRSLD IDGKKVKMQV WDTAGQERFR TITQSYYRSA HAAIIAYDLT 100
RRSTFESIPH WIHEIEKYGA ANVVIMLIGN KCDLWEKRHV LFEDACTLAE 150
KYGLLAVLET SAKESKNIEE VFVLMAKELI ARNSLHLYGE SALNGLPLDS 200
SPVLMAQGPS EKTHCTC 217
Length:217
Mass (Da):24,400
Last modified:September 11, 2007 - v2
Checksum:i787695528A6EE366
GO
Isoform 2 (identifier: A4D1S5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-67: K → KNSSASIITFASIQIHGQTQKMSPQIWTKSSHYLWEPLIWTLLPVLLQ

Note: No experimental confirmation available.

Show »
Length:264
Mass (Da):29,776
Checksum:i80C094721C166813
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei67 – 671K → KNSSASIITFASIQIHGQTQ KMSPQIWTKSSHYLWEPLIW TLLPVLLQ in isoform 2.
VSP_036588

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti31 – 311T → S in AAF00046. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC069335 Genomic DNA. No translation available.
AC093087 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24028.1.
CH236950 Genomic DNA. Translation: EAL24029.1.
BC140796 mRNA. Translation: AAI40797.1.
AF091033 mRNA. Translation: AAF00046.1.
CCDSiCCDS34762.2. [A4D1S5-1]
RefSeqiNP_001008749.2. NM_001008749.2. [A4D1S5-1]
XP_005250053.1. XM_005249996.1. [A4D1S5-1]
XP_006716049.1. XM_006715986.1. [A4D1S5-1]
UniGeneiHs.583545.

Genome annotation databases

EnsembliENST00000275874; ENSP00000275874; ENSG00000146955. [A4D1S5-2]
ENST00000356407; ENSP00000348778; ENSG00000146955. [A4D1S5-1]
ENST00000537763; ENSP00000440167; ENSG00000146955. [A4D1S5-1]
GeneIDi401409.
KEGGihsa:401409.
UCSCiuc010lni.2. human. [A4D1S5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC069335 Genomic DNA. No translation available.
AC093087 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24028.1 .
CH236950 Genomic DNA. Translation: EAL24029.1 .
BC140796 mRNA. Translation: AAI40797.1 .
AF091033 mRNA. Translation: AAF00046.1 .
CCDSi CCDS34762.2. [A4D1S5-1 ]
RefSeqi NP_001008749.2. NM_001008749.2. [A4D1S5-1 ]
XP_005250053.1. XM_005249996.1. [A4D1S5-1 ]
XP_006716049.1. XM_006715986.1. [A4D1S5-1 ]
UniGenei Hs.583545.

3D structure databases

ProteinModelPortali A4D1S5.
SMRi A4D1S5. Positions 14-183.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000275874.

PTM databases

PhosphoSitei A4D1S5.

Proteomic databases

MaxQBi A4D1S5.
PaxDbi A4D1S5.
PRIDEi A4D1S5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000275874 ; ENSP00000275874 ; ENSG00000146955 . [A4D1S5-2 ]
ENST00000356407 ; ENSP00000348778 ; ENSG00000146955 . [A4D1S5-1 ]
ENST00000537763 ; ENSP00000440167 ; ENSG00000146955 . [A4D1S5-1 ]
GeneIDi 401409.
KEGGi hsa:401409.
UCSCi uc010lni.2. human. [A4D1S5-1 ]

Organism-specific databases

CTDi 401409.
GeneCardsi GC07P140103.
HGNCi HGNC:19982. RAB19.
HPAi HPA051077.
neXtProti NX_A4D1S5.
PharmGKBi PA162400617.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
HOGENOMi HOG000233968.
HOVERGENi HBG009351.
KOi K17047.
OMAi NKCDLWE.
PhylomeDBi A4D1S5.
TreeFami TF300097.

Miscellaneous databases

GenomeRNAii 401409.
NextBioi 106817.
PROi A4D1S5.

Gene expression databases

ArrayExpressi A4D1S5.
Bgeei A4D1S5.
CleanExi HS_RAB19.
Genevestigatori A4D1S5.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view ]
Pfami PF00071. Ras. 1 hit.
[Graphical view ]
PRINTSi PR00449. RASTRNSFRMNG.
SMARTi SM00175. RAB. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS51419. RAB. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Rab GTPases expressed in Caco-2 cells."
    Opdam F.J.M., van Bokhoven H., Kamps G., Ginsel L.A., Fransen J.A.M.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-71 (ISOFORM 1).
    Tissue: Colon carcinoma.

Entry informationi

Entry nameiRAB19_HUMAN
AccessioniPrimary (citable) accession number: A4D1S5
Secondary accession number(s): A4D1S6
, B2RTS6, B5MDR2, Q9UL27
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: July 9, 2014
This is version 69 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi