Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A4D1S5 (RAB19_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 69. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ras-related protein Rab-19
Gene names
Name:RAB19
Synonyms:RAB19B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length217 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Cell membrane; Lipid-anchor; Cytoplasmic side Potential.

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A4D1S5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A4D1S5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     67-67: K → KNSSASIITFASIQIHGQTQKMSPQIWTKSSHYLWEPLIWTLLPVLLQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 217217Ras-related protein Rab-19
PRO_0000300459

Regions

Nucleotide binding24 – 318GTP By similarity
Nucleotide binding72 – 765GTP By similarity
Nucleotide binding130 – 1334GTP By similarity
Motif46 – 549Effector region By similarity

Amino acid modifications

Modified residue2171Cysteine methyl ester By similarity
Lipidation2151S-geranylgeranyl cysteine By similarity
Lipidation2171S-geranylgeranyl cysteine By similarity

Natural variations

Alternative sequence671K → KNSSASIITFASIQIHGQTQ KMSPQIWTKSSHYLWEPLIW TLLPVLLQ in isoform 2.
VSP_036588

Experimental info

Sequence conflict311T → S in AAF00046. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 11, 2007. Version 2.
Checksum: 787695528A6EE366

FASTA21724,400
        10         20         30         40         50         60 
MHFSSSARAA DENFDYLFKI ILIGDSNVGK TCVVQHFKSG VYTETQQNTI GVDFTVRSLD 

        70         80         90        100        110        120 
IDGKKVKMQV WDTAGQERFR TITQSYYRSA HAAIIAYDLT RRSTFESIPH WIHEIEKYGA 

       130        140        150        160        170        180 
ANVVIMLIGN KCDLWEKRHV LFEDACTLAE KYGLLAVLET SAKESKNIEE VFVLMAKELI 

       190        200        210 
ARNSLHLYGE SALNGLPLDS SPVLMAQGPS EKTHCTC 

« Hide

Isoform 2 [UniParc].

Checksum: 80C094721C166813
Show »

FASTA26429,776

References

« Hide 'large scale' references
[1]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"Rab GTPases expressed in Caco-2 cells."
Opdam F.J.M., van Bokhoven H., Kamps G., Ginsel L.A., Fransen J.A.M.
Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-71 (ISOFORM 1).
Tissue: Colon carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC069335 Genomic DNA. No translation available.
AC093087 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24028.1.
CH236950 Genomic DNA. Translation: EAL24029.1.
BC140796 mRNA. Translation: AAI40797.1.
AF091033 mRNA. Translation: AAF00046.1.
CCDSCCDS34762.2. [A4D1S5-1]
RefSeqNP_001008749.2. NM_001008749.2. [A4D1S5-1]
XP_005250053.1. XM_005249996.1. [A4D1S5-1]
XP_006716049.1. XM_006715986.1. [A4D1S5-1]
UniGeneHs.583545.

3D structure databases

ProteinModelPortalA4D1S5.
SMRA4D1S5. Positions 14-183.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000275874.

PTM databases

PhosphoSiteA4D1S5.

Proteomic databases

MaxQBA4D1S5.
PaxDbA4D1S5.
PRIDEA4D1S5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000275874; ENSP00000275874; ENSG00000146955. [A4D1S5-2]
ENST00000356407; ENSP00000348778; ENSG00000146955. [A4D1S5-1]
ENST00000537763; ENSP00000440167; ENSG00000146955. [A4D1S5-1]
GeneID401409.
KEGGhsa:401409.
UCSCuc010lni.2. human. [A4D1S5-1]

Organism-specific databases

CTD401409.
GeneCardsGC07P140103.
HGNCHGNC:19982. RAB19.
HPAHPA051077.
neXtProtNX_A4D1S5.
PharmGKBPA162400617.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1100.
HOGENOMHOG000233968.
HOVERGENHBG009351.
KOK17047.
OMANKCDLWE.
PhylomeDBA4D1S5.
TreeFamTF300097.

Gene expression databases

ArrayExpressA4D1S5.
BgeeA4D1S5.
CleanExHS_RAB19.
GenevestigatorA4D1S5.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamPF00071. Ras. 1 hit.
[Graphical view]
PRINTSPR00449. RASTRNSFRMNG.
SMARTSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
TIGRFAMsTIGR00231. small_GTP. 1 hit.
PROSITEPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi401409.
NextBio106817.
PROA4D1S5.

Entry information

Entry nameRAB19_HUMAN
AccessionPrimary (citable) accession number: A4D1S5
Secondary accession number(s): A4D1S6 expand/collapse secondary AC list , B2RTS6, B5MDR2, Q9UL27
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: July 9, 2014
This is version 69 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM