Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-19

Gene

RAB19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi24 – 318GTPBy similarity
Nucleotide bindingi72 – 765GTPBy similarity
Nucleotide bindingi130 – 1334GTPBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-19
Gene namesi
Name:RAB19
Synonyms:RAB19B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:19982. RAB19.

Subcellular locationi

GO - Cellular componenti

  • endosome Source: GO_Central
  • extracellular exosome Source: UniProtKB
  • Golgi apparatus Source: GO_Central
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400617.

Polymorphism and mutation databases

BioMutaiRAB19.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 217217Ras-related protein Rab-19PRO_0000300459Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi215 – 2151S-geranylgeranyl cysteineBy similarity
Modified residuei217 – 2171Cysteine methyl esterBy similarity
Lipidationi217 – 2171S-geranylgeranyl cysteineBy similarity

Keywords - PTMi

Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiA4D1S5.
PaxDbiA4D1S5.
PRIDEiA4D1S5.

PTM databases

PhosphoSiteiA4D1S5.

Expressioni

Gene expression databases

BgeeiA4D1S5.
CleanExiHS_RAB19.
ExpressionAtlasiA4D1S5. baseline and differential.

Organism-specific databases

HPAiHPA051077.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000348778.

Structurei

3D structure databases

ProteinModelPortaliA4D1S5.
SMRiA4D1S5. Positions 14-207.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi46 – 549Effector regionBy similarity

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00760000118841.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiA4D1S5.
KOiK17047.
OMAiNKCDLWE.
PhylomeDBiA4D1S5.
TreeFamiTF300097.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A4D1S5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHFSSSARAA DENFDYLFKI ILIGDSNVGK TCVVQHFKSG VYTETQQNTI
60 70 80 90 100
GVDFTVRSLD IDGKKVKMQV WDTAGQERFR TITQSYYRSA HAAIIAYDLT
110 120 130 140 150
RRSTFESIPH WIHEIEKYGA ANVVIMLIGN KCDLWEKRHV LFEDACTLAE
160 170 180 190 200
KYGLLAVLET SAKESKNIEE VFVLMAKELI ARNSLHLYGE SALNGLPLDS
210
SPVLMAQGPS EKTHCTC
Length:217
Mass (Da):24,400
Last modified:September 11, 2007 - v2
Checksum:i787695528A6EE366
GO
Isoform 2 (identifier: A4D1S5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-67: K → KNSSASIITFASIQIHGQTQKMSPQIWTKSSHYLWEPLIWTLLPVLLQ

Note: No experimental confirmation available.
Show »
Length:264
Mass (Da):29,776
Checksum:i80C094721C166813
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti31 – 311T → S in AAF00046 (Ref. 4) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei67 – 671K → KNSSASIITFASIQIHGQTQ KMSPQIWTKSSHYLWEPLIW TLLPVLLQ in isoform 2. CuratedVSP_036588

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC069335 Genomic DNA. No translation available.
AC093087 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24028.1.
CH236950 Genomic DNA. Translation: EAL24029.1.
BC140796 mRNA. Translation: AAI40797.1.
AF091033 mRNA. Translation: AAF00046.1.
CCDSiCCDS34762.2. [A4D1S5-1]
RefSeqiNP_001008749.2. NM_001008749.2. [A4D1S5-1]
XP_005250053.1. XM_005249996.2. [A4D1S5-1]
XP_006716049.1. XM_006715986.2. [A4D1S5-1]
UniGeneiHs.583545.

Genome annotation databases

EnsembliENST00000356407; ENSP00000348778; ENSG00000146955. [A4D1S5-1]
ENST00000537763; ENSP00000440167; ENSG00000146955. [A4D1S5-1]
GeneIDi401409.
KEGGihsa:401409.
UCSCiuc010lni.2. human. [A4D1S5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC069335 Genomic DNA. No translation available.
AC093087 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24028.1.
CH236950 Genomic DNA. Translation: EAL24029.1.
BC140796 mRNA. Translation: AAI40797.1.
AF091033 mRNA. Translation: AAF00046.1.
CCDSiCCDS34762.2. [A4D1S5-1]
RefSeqiNP_001008749.2. NM_001008749.2. [A4D1S5-1]
XP_005250053.1. XM_005249996.2. [A4D1S5-1]
XP_006716049.1. XM_006715986.2. [A4D1S5-1]
UniGeneiHs.583545.

3D structure databases

ProteinModelPortaliA4D1S5.
SMRiA4D1S5. Positions 14-207.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000348778.

PTM databases

PhosphoSiteiA4D1S5.

Polymorphism and mutation databases

BioMutaiRAB19.

Proteomic databases

MaxQBiA4D1S5.
PaxDbiA4D1S5.
PRIDEiA4D1S5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356407; ENSP00000348778; ENSG00000146955. [A4D1S5-1]
ENST00000537763; ENSP00000440167; ENSG00000146955. [A4D1S5-1]
GeneIDi401409.
KEGGihsa:401409.
UCSCiuc010lni.2. human. [A4D1S5-1]

Organism-specific databases

CTDi401409.
GeneCardsiGC07P140103.
HGNCiHGNC:19982. RAB19.
HPAiHPA051077.
neXtProtiNX_A4D1S5.
PharmGKBiPA162400617.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00760000118841.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiA4D1S5.
KOiK17047.
OMAiNKCDLWE.
PhylomeDBiA4D1S5.
TreeFamiTF300097.

Miscellaneous databases

GenomeRNAii401409.
NextBioi106817.
PROiA4D1S5.

Gene expression databases

BgeeiA4D1S5.
CleanExiHS_RAB19.
ExpressionAtlasiA4D1S5. baseline and differential.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Rab GTPases expressed in Caco-2 cells."
    Opdam F.J.M., van Bokhoven H., Kamps G., Ginsel L.A., Fransen J.A.M.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-71 (ISOFORM 1).
    Tissue: Colon carcinoma.

Entry informationi

Entry nameiRAB19_HUMAN
AccessioniPrimary (citable) accession number: A4D1S5
Secondary accession number(s): A4D1S6
, B2RTS6, B5MDR2, Q9UL27
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: June 24, 2015
This is version 77 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.