A4D1S5 (RAB19_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 57.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras-related protein Rab-19 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 217 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Cell membrane; Lipid-anchor; Cytoplasmic side Potential. |
| Sequence similarities | Belongs to the small GTPase superfamily. Rab family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Lipoprotein Methylation Prenylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein transport Inferred from electronic annotation. Source: InterPro small GTPase mediated signal transductionInferred from electronic annotation. Source: InterPro |
| Cellular_component | plasma membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: A4D1S5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: A4D1S5-2) The sequence of this isoform differs from the canonical sequence as follows: 67-67: K → KNSSASIITFASIQIHGQTQKMSPQIWTKSSHYLWEPLIWTLLPVLLQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 217 | 217 | Ras-related protein Rab-19 | PRO_0000300459 | |||||
Regions | |||||||||
| Nucleotide binding | 24 – 31 | 8 | GTP By similarity | ||||||
| Nucleotide binding | 72 – 76 | 5 | GTP By similarity | ||||||
| Nucleotide binding | 130 – 133 | 4 | GTP By similarity | ||||||
| Motif | 46 – 54 | 9 | Effector region By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 217 | 1 | Cysteine methyl ester By similarity | ||||||
| Lipidation | 215 | 1 | S-geranylgeranyl cysteine By similarity | ||||||
| Lipidation | 217 | 1 | S-geranylgeranyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 67 | 1 | K → KNSSASIITFASIQIHGQTQ KMSPQIWTKSSHYLWEPLIW TLLPVLLQ in isoform 2. | VSP_036588 | |||||
Experimental info | |||||||||
| Sequence conflict | 31 | 1 | T → S in AAF00046. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC069335 Genomic DNA. No translation available. AC093087 Genomic DNA. No translation available. CH236950 Genomic DNA. Translation: EAL24028.1. CH236950 Genomic DNA. Translation: EAL24029.1. BC140796 mRNA. Translation: AAI40797.1. AF091033 mRNA. Translation: AAF00046.1. |
| IPI | IPI00478209. IPI00923598. |
| RefSeq | NP_001008749.2. NM_001008749.2. |
| UniGene | Hs.583545. |
3D structure databases | |
| ProteinModelPortal | A4D1S5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000275874. |
PTM databases | |
| PhosphoSite | A4D1S5. |
Proteomic databases | |
| PaxDb | A4D1S5. |
| PRIDE | A4D1S5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000275874; ENSP00000275874; ENSG00000146955. ENST00000356407; ENSP00000348778; ENSG00000146955. ENST00000537763; ENSP00000440167; ENSG00000146955. |
| GeneID | 401409. |
| KEGG | hsa:401409. |
| UCSC | uc010lni.2. human. |
Organism-specific databases | |
| CTD | 401409. |
| GeneCards | GC07P140103. |
| HGNC | HGNC:19982. RAB19. |
| HPA | HPA051077. |
| neXtProt | NX_A4D1S5. |
| PharmGKB | PA162400617. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1100. |
| HOGENOM | HOG000233968. |
| HOVERGEN | HBG009351. |
| OMA | RNSLHLY. |
Gene expression databases | |
| ArrayExpress | A4D1S5. |
| Bgee | A4D1S5. |
| CleanEx | HS_RAB19. |
| Genevestigator | A4D1S5. |
Family and domain databases | |
| InterPro | IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. IPR003579. Small_GTPase_Rab_type. [Graphical view] |
| Pfam | PF00071. Ras. 1 hit. [Graphical view] |
| PRINTS | PR00449. RASTRNSFRMNG. |
| SMART | SM00175. RAB. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00231. small_GTP. 1 hit. |
| PROSITE | PS51419. RAB. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 401409. |
| NextBio | 106817. |
Entry information
| Entry name | RAB19_HUMAN | ||||||||
| Accession | Primary (citable) accession number: A4D1S5 Secondary accession number(s): A4D1S6 Q9UL27 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
