Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A4D1S5

- RAB19_HUMAN

UniProt

A4D1S5 - RAB19_HUMAN

Protein

Ras-related protein Rab-19

Gene

RAB19

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 70 (01 Oct 2014)
      Sequence version 2 (11 Sep 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi24 – 318GTPBy similarity
    Nucleotide bindingi72 – 765GTPBy similarity
    Nucleotide bindingi130 – 1334GTPBy similarity

    GO - Molecular functioni

    1. GTP binding Source: UniProtKB-KW

    GO - Biological processi

    1. protein transport Source: InterPro
    2. small GTPase mediated signal transduction Source: InterPro

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-related protein Rab-19
    Gene namesi
    Name:RAB19
    Synonyms:RAB19B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:19982. RAB19.

    Subcellular locationi

    Cell membrane Curated; Lipid-anchor Curated; Cytoplasmic side Curated

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162400617.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 217217Ras-related protein Rab-19PRO_0000300459Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi215 – 2151S-geranylgeranyl cysteineBy similarity
    Modified residuei217 – 2171Cysteine methyl esterBy similarity
    Lipidationi217 – 2171S-geranylgeranyl cysteineBy similarity

    Keywords - PTMi

    Lipoprotein, Methylation, Prenylation

    Proteomic databases

    MaxQBiA4D1S5.
    PaxDbiA4D1S5.
    PRIDEiA4D1S5.

    PTM databases

    PhosphoSiteiA4D1S5.

    Expressioni

    Gene expression databases

    ArrayExpressiA4D1S5.
    BgeeiA4D1S5.
    CleanExiHS_RAB19.
    GenevestigatoriA4D1S5.

    Organism-specific databases

    HPAiHPA051077.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000275874.

    Structurei

    3D structure databases

    ProteinModelPortaliA4D1S5.
    SMRiA4D1S5. Positions 14-183.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi46 – 549Effector regionBy similarity

    Sequence similaritiesi

    Belongs to the small GTPase superfamily. Rab family.Curated

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000233968.
    HOVERGENiHBG009351.
    KOiK17047.
    OMAiNKCDLWE.
    PhylomeDBiA4D1S5.
    TreeFamiTF300097.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view]
    PfamiPF00071. Ras. 1 hit.
    [Graphical view]
    PRINTSiPR00449. RASTRNSFRMNG.
    SMARTiSM00175. RAB. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00231. small_GTP. 1 hit.
    PROSITEiPS51419. RAB. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A4D1S5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHFSSSARAA DENFDYLFKI ILIGDSNVGK TCVVQHFKSG VYTETQQNTI    50
    GVDFTVRSLD IDGKKVKMQV WDTAGQERFR TITQSYYRSA HAAIIAYDLT 100
    RRSTFESIPH WIHEIEKYGA ANVVIMLIGN KCDLWEKRHV LFEDACTLAE 150
    KYGLLAVLET SAKESKNIEE VFVLMAKELI ARNSLHLYGE SALNGLPLDS 200
    SPVLMAQGPS EKTHCTC 217
    Length:217
    Mass (Da):24,400
    Last modified:September 11, 2007 - v2
    Checksum:i787695528A6EE366
    GO
    Isoform 2 (identifier: A4D1S5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         67-67: K → KNSSASIITFASIQIHGQTQKMSPQIWTKSSHYLWEPLIWTLLPVLLQ

    Note: No experimental confirmation available.

    Show »
    Length:264
    Mass (Da):29,776
    Checksum:i80C094721C166813
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti31 – 311T → S in AAF00046. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei67 – 671K → KNSSASIITFASIQIHGQTQ KMSPQIWTKSSHYLWEPLIW TLLPVLLQ in isoform 2. CuratedVSP_036588

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC069335 Genomic DNA. No translation available.
    AC093087 Genomic DNA. No translation available.
    CH236950 Genomic DNA. Translation: EAL24028.1.
    CH236950 Genomic DNA. Translation: EAL24029.1.
    BC140796 mRNA. Translation: AAI40797.1.
    AF091033 mRNA. Translation: AAF00046.1.
    CCDSiCCDS34762.2. [A4D1S5-1]
    RefSeqiNP_001008749.2. NM_001008749.2. [A4D1S5-1]
    XP_005250053.1. XM_005249996.1. [A4D1S5-1]
    XP_006716049.1. XM_006715986.1. [A4D1S5-1]
    UniGeneiHs.583545.

    Genome annotation databases

    EnsembliENST00000356407; ENSP00000348778; ENSG00000146955. [A4D1S5-1]
    ENST00000537763; ENSP00000440167; ENSG00000146955. [A4D1S5-1]
    GeneIDi401409.
    KEGGihsa:401409.
    UCSCiuc010lni.2. human. [A4D1S5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC069335 Genomic DNA. No translation available.
    AC093087 Genomic DNA. No translation available.
    CH236950 Genomic DNA. Translation: EAL24028.1 .
    CH236950 Genomic DNA. Translation: EAL24029.1 .
    BC140796 mRNA. Translation: AAI40797.1 .
    AF091033 mRNA. Translation: AAF00046.1 .
    CCDSi CCDS34762.2. [A4D1S5-1 ]
    RefSeqi NP_001008749.2. NM_001008749.2. [A4D1S5-1 ]
    XP_005250053.1. XM_005249996.1. [A4D1S5-1 ]
    XP_006716049.1. XM_006715986.1. [A4D1S5-1 ]
    UniGenei Hs.583545.

    3D structure databases

    ProteinModelPortali A4D1S5.
    SMRi A4D1S5. Positions 14-183.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000275874.

    PTM databases

    PhosphoSitei A4D1S5.

    Proteomic databases

    MaxQBi A4D1S5.
    PaxDbi A4D1S5.
    PRIDEi A4D1S5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000356407 ; ENSP00000348778 ; ENSG00000146955 . [A4D1S5-1 ]
    ENST00000537763 ; ENSP00000440167 ; ENSG00000146955 . [A4D1S5-1 ]
    GeneIDi 401409.
    KEGGi hsa:401409.
    UCSCi uc010lni.2. human. [A4D1S5-1 ]

    Organism-specific databases

    CTDi 401409.
    GeneCardsi GC07P140103.
    HGNCi HGNC:19982. RAB19.
    HPAi HPA051077.
    neXtProti NX_A4D1S5.
    PharmGKBi PA162400617.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000233968.
    HOVERGENi HBG009351.
    KOi K17047.
    OMAi NKCDLWE.
    PhylomeDBi A4D1S5.
    TreeFami TF300097.

    Miscellaneous databases

    GenomeRNAii 401409.
    NextBioi 106817.
    PROi A4D1S5.

    Gene expression databases

    ArrayExpressi A4D1S5.
    Bgeei A4D1S5.
    CleanExi HS_RAB19.
    Genevestigatori A4D1S5.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view ]
    Pfami PF00071. Ras. 1 hit.
    [Graphical view ]
    PRINTSi PR00449. RASTRNSFRMNG.
    SMARTi SM00175. RAB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00231. small_GTP. 1 hit.
    PROSITEi PS51419. RAB. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Rab GTPases expressed in Caco-2 cells."
      Opdam F.J.M., van Bokhoven H., Kamps G., Ginsel L.A., Fransen J.A.M.
      Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-71 (ISOFORM 1).
      Tissue: Colon carcinoma.

    Entry informationi

    Entry nameiRAB19_HUMAN
    AccessioniPrimary (citable) accession number: A4D1S5
    Secondary accession number(s): A4D1S6
    , B2RTS6, B5MDR2, Q9UL27
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: September 11, 2007
    Last modified: October 1, 2014
    This is version 70 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3