Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

A2RUR9

- C144A_HUMAN

UniProt

A2RUR9 - C144A_HUMAN

Protein

Coiled-coil domain-containing protein 144A

Gene

CCDC144A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 59 (01 Oct 2014)
      Sequence version 1 (06 Mar 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Coiled-coil domain-containing protein 144A
    Gene namesi
    Name:CCDC144A
    Synonyms:KIAA0565
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:29072. CCDC144A.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162381473.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14271427Coiled-coil domain-containing protein 144APRO_0000312279Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki955 – 955Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

    Keywords - PTMi

    Isopeptide bond, Ubl conjugation

    Proteomic databases

    PaxDbiA2RUR9.
    PRIDEiA2RUR9.

    PTM databases

    PhosphoSiteiA2RUR9.

    Expressioni

    Gene expression databases

    BgeeiA2RUR9.
    GenevestigatoriA2RUR9.

    Organism-specific databases

    HPAiHPA022996.
    HPA023009.
    HPA047851.

    Interactioni

    Protein-protein interaction databases

    BioGridi115069. 1 interaction.
    STRINGi9606.ENSP00000353717.

    Structurei

    3D structure databases

    ProteinModelPortaliA2RUR9.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili490 – 54556Sequence AnalysisAdd
    BLAST
    Coiled coili648 – 1129482Sequence AnalysisAdd
    BLAST
    Coiled coili1155 – 1309155Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1394 – 14007Poly-Ser

    Sequence similaritiesi

    Belongs to the CCDC144 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG125406.
    HOGENOMiHOG000098303.
    HOVERGENiHBG107542.
    InParanoidiA2RUR9.
    OMAiKENGEHD.
    PhylomeDBiA2RUR9.
    TreeFamiTF342629.

    Family and domain databases

    InterProiIPR021885. DUF3496.
    [Graphical view]
    PfamiPF12001. DUF3496. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: A2RUR9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASWGGEKRG GAEGSPKPAV YATRKTPSVG SQGDQWYLGY PGDQWSSGFP     50
    YSWWKNSVGS ESKHGEGALD QPQHDVRLED LGELHRAARS GDVPGVEHIL 100
    APGDTGVDKR DRKKSIQQLV PEYKEKQTPE SLPQNNNPDW HPTNLTLSDE 150
    TCQRSKNLKV DDKCPSVSPS MPENQSATKE LGQMNLTERE KMDTGVVLLS 200
    GNDTLHDLCQ SQLPENKESK EAEQDSELTS EEEQERLKGC ENKQPQKTSQ 250
    EPEMAKDCDR EDIPIYPVLP HVQKSEEMWI EQGKLEWKNQ LKLVINELKQ 300
    RFGEIYEKYK IPACPEEEPL LDNSTRGTDV KDIPFNLTNN IPGCEEEDAS 350
    EISVSVVFET FPEQKEPSLK NIIHPYYHPY SGSQEHVCQS SSKFHLHENK 400
    LDCDNDNKPG IGHIFSTDKN FHNDASTKKA RNPEVVMVEM KEDQEFDLQM 450
    TKNMNQNSDS GSTNNYKSLK PKLENLSSLP PDSDRTSEVY LHEELQQDMQ 500
    KFKNEVNTLE EEFLALKKED VQLHKDVEEE MEKHRSNSTE LSGTLTDGTT 550
    VGNDDDGLNQ QIPRKENGEH DRPADKTSNE KNEVKNQIYP EADFADSMEP 600
    SEIASEDCEL SHSVYENFML LIEQLRMEYK DSASLPRIQD TFCLCEHLLK 650
    LKNNHCDQLT VKLKQMENMV SVLQNELSET KKTKLQLELQ KIEWEKELYD 700
    LRLALKQENE EKRNADMLYN KDSEQLRIKE EECGKVVETK QQLKWNLRRL 750
    VKELRTVRNN LDLVVQERND AQKQLSEEQD ARILQDQILT SKQKELEMAR 800
    KKMNSEISHR HQKEKDLFHE DCMLQEEIAL LRLEIDTIKN QNKQKEKKYF 850
    EDIEAVKEKN DNLQKIIKLN EETLTETILQ YSGQLNNLTA ENKILNSELE 900
    NGKQNQERLE IEMESYRCRL AAAVRDCDQS QTARDLKLDF QRTRQEWVRL 950
    HDKMKVDMSG LQAKNEILSE KLSNAESKIN SLQIQLHNTR DALGRESLIL 1000
    ERVQRDLSQT QCQKKETEQM YQIEQSKLKK YIAKQESVEE RLSQLQSENM 1050
    LLRQQLDDAH KKANSQEKTS STIQDQFHSA AKNLQAESEK QILSLQEKNK 1100
    ELMDEYNHLK ERMDQCEKEK AGRKIDLTEA QETVPSRCLH LDAENEVLQL 1150
    QQTLFSMKAI QKQCETLQKN KKQLKQEVVN LKSYMERNML ERGKAEWHKL 1200
    LIEERARKEI EEKLNEAILT LQKQAAVSHE QLVQLREDNT TSIKTQMELT 1250
    IKDLESEISR IKTSQADFNK TELERYKELY LEEVKVRESL SNELSRTNEM 1300
    IAEVSTQLTV EKEQTRSRSL FTAYATRPVL ESPCVGNLND SEGLNRKHIP 1350
    RKKRSALKDM ESYLLKMQQK LQNDLTAEVA GSSQTGLHRI PQCSSFSSSS 1400
    LHLLLCSICQ PFFLILQLLL NMNLDPI 1427
    Length:1,427
    Mass (Da):165,125
    Last modified:March 6, 2007 - v1
    Checksum:i9538A4F523D8D5C5
    GO
    Isoform 2 (identifier: A2RUR9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-697: Missing.
         698-701: LYDL → MFNC
         1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

    Note: No experimental confirmation available.

    Show »
    Length:691
    Mass (Da):81,413
    Checksum:i7EC2982584939442
    GO
    Isoform 3 (identifier: A2RUR9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         247-526: Missing.
         1124-1124: K → KVVMREFQQEWTDLLKQQPTSEATSRCHINLDETQDSKKKLGQIRSE
         1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

    Show »
    Length:1,154
    Mass (Da):133,874
    Checksum:i0A3298D43B081F1D
    GO

    Sequence cautioni

    The sequence BAA25491.2 differs from that shown. Reason: Frameshift at position 1322.
    The sequence BAC86369.1 differs from that shown. Reason: Frameshift at position 953.
    The sequence BAA25491.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1085 – 10851Q → R in BAC86369. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 697697Missing in isoform 2. 1 PublicationVSP_029787Add
    BLAST
    Alternative sequencei247 – 526280Missing in isoform 3. 1 PublicationVSP_029788Add
    BLAST
    Alternative sequencei698 – 7014LYDL → MFNC in isoform 2. 1 PublicationVSP_029789
    Alternative sequencei1124 – 11241K → KVVMREFQQEWTDLLKQQPT SEATSRCHINLDETQDSKKK LGQIRSE in isoform 3. 1 PublicationVSP_029790
    Alternative sequencei1367 – 142761MQQKL…NLDPI → VSYLFSFGVQISDRILVCYL VK in isoform 2 and isoform 3. 2 PublicationsVSP_029791Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB011137 mRNA. Translation: BAA25491.2. Sequence problems.
    AC098850 Genomic DNA. No translation available.
    BC133019 mRNA. Translation: AAI33020.1.
    AK125971 mRNA. Translation: BAC86369.1. Frameshift.
    CCDSiCCDS45621.1. [A2RUR9-1]
    RefSeqiNP_055510.1. NM_014695.1. [A2RUR9-1]
    UniGeneiHs.745246.

    Genome annotation databases

    EnsembliENST00000360524; ENSP00000353717; ENSG00000170160. [A2RUR9-1]
    GeneIDi9720.
    KEGGihsa:9720.
    UCSCiuc002gqk.1. human. [A2RUR9-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB011137 mRNA. Translation: BAA25491.2 . Sequence problems.
    AC098850 Genomic DNA. No translation available.
    BC133019 mRNA. Translation: AAI33020.1 .
    AK125971 mRNA. Translation: BAC86369.1 . Frameshift.
    CCDSi CCDS45621.1. [A2RUR9-1 ]
    RefSeqi NP_055510.1. NM_014695.1. [A2RUR9-1 ]
    UniGenei Hs.745246.

    3D structure databases

    ProteinModelPortali A2RUR9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115069. 1 interaction.
    STRINGi 9606.ENSP00000353717.

    PTM databases

    PhosphoSitei A2RUR9.

    Proteomic databases

    PaxDbi A2RUR9.
    PRIDEi A2RUR9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000360524 ; ENSP00000353717 ; ENSG00000170160 . [A2RUR9-1 ]
    GeneIDi 9720.
    KEGGi hsa:9720.
    UCSCi uc002gqk.1. human. [A2RUR9-1 ]

    Organism-specific databases

    CTDi 9720.
    GeneCardsi GC17P016592.
    HGNCi HGNC:29072. CCDC144A.
    HPAi HPA022996.
    HPA023009.
    HPA047851.
    neXtProti NX_A2RUR9.
    PharmGKBi PA162381473.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG125406.
    HOGENOMi HOG000098303.
    HOVERGENi HBG107542.
    InParanoidi A2RUR9.
    OMAi KENGEHD.
    PhylomeDBi A2RUR9.
    TreeFami TF342629.

    Miscellaneous databases

    GenomeRNAii 9720.
    NextBioi 36553.
    PROi A2RUR9.

    Gene expression databases

    Bgeei A2RUR9.
    Genevestigatori A2RUR9.

    Family and domain databases

    InterProi IPR021885. DUF3496.
    [Graphical view ]
    Pfami PF12001. DUF3496. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    2. Ohara O., Nagase T., Ishikawa K.
      Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 238-1410 (ISOFORM 3).
      Tissue: Testis.
    6. "Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells."
      Tan F., Lu L., Cai Y., Wang J., Xie Y., Wang L., Gong Y., Xu B.-E., Wu J., Luo Y., Qiang B., Yuan J., Sun X., Peng X.
      Proteomics 8:2885-2896(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-955.
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiC144A_HUMAN
    AccessioniPrimary (citable) accession number: A2RUR9
    Secondary accession number(s): O60311, Q6ZU57
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: March 6, 2007
    Last modified: October 1, 2014
    This is version 59 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3