Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

A2RUR9 (C144A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 56. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Coiled-coil domain-containing protein 144A
Gene names
Name:CCDC144A
Synonyms:KIAA0565
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1427 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Belongs to the CCDC144 family.

Sequence caution

The sequence BAA25491.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAA25491.2 differs from that shown. Reason: Frameshift at position 1322.

The sequence BAC86369.1 differs from that shown. Reason: Frameshift at position 953.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   PTMIsopeptide bond
Ubl conjugation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: A2RUR9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: A2RUR9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-697: Missing.
     698-701: LYDL → MFNC
     1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK
Note: No experimental confirmation available.
Isoform 3 (identifier: A2RUR9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     247-526: Missing.
     1124-1124: K → KVVMREFQQEWTDLLKQQPTSEATSRCHINLDETQDSKKKLGQIRSE
     1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14271427Coiled-coil domain-containing protein 144A
PRO_0000312279

Regions

Coiled coil490 – 54556 Potential
Coiled coil648 – 1129482 Potential
Coiled coil1155 – 1309155 Potential
Compositional bias1394 – 14007Poly-Ser

Amino acid modifications

Cross-link955Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.6

Natural variations

Alternative sequence1 – 697697Missing in isoform 2.
VSP_029787
Alternative sequence247 – 526280Missing in isoform 3.
VSP_029788
Alternative sequence698 – 7014LYDL → MFNC in isoform 2.
VSP_029789
Alternative sequence11241K → KVVMREFQQEWTDLLKQQPT SEATSRCHINLDETQDSKKK LGQIRSE in isoform 3.
VSP_029790
Alternative sequence1367 – 142761MQQKL…NLDPI → VSYLFSFGVQISDRILVCYL VK in isoform 2 and isoform 3.
VSP_029791

Experimental info

Sequence conflict10851Q → R in BAC86369. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 6, 2007. Version 1.
Checksum: 9538A4F523D8D5C5

FASTA1,427165,125
        10         20         30         40         50         60 
MASWGGEKRG GAEGSPKPAV YATRKTPSVG SQGDQWYLGY PGDQWSSGFP YSWWKNSVGS 

        70         80         90        100        110        120 
ESKHGEGALD QPQHDVRLED LGELHRAARS GDVPGVEHIL APGDTGVDKR DRKKSIQQLV 

       130        140        150        160        170        180 
PEYKEKQTPE SLPQNNNPDW HPTNLTLSDE TCQRSKNLKV DDKCPSVSPS MPENQSATKE 

       190        200        210        220        230        240 
LGQMNLTERE KMDTGVVLLS GNDTLHDLCQ SQLPENKESK EAEQDSELTS EEEQERLKGC 

       250        260        270        280        290        300 
ENKQPQKTSQ EPEMAKDCDR EDIPIYPVLP HVQKSEEMWI EQGKLEWKNQ LKLVINELKQ 

       310        320        330        340        350        360 
RFGEIYEKYK IPACPEEEPL LDNSTRGTDV KDIPFNLTNN IPGCEEEDAS EISVSVVFET 

       370        380        390        400        410        420 
FPEQKEPSLK NIIHPYYHPY SGSQEHVCQS SSKFHLHENK LDCDNDNKPG IGHIFSTDKN 

       430        440        450        460        470        480 
FHNDASTKKA RNPEVVMVEM KEDQEFDLQM TKNMNQNSDS GSTNNYKSLK PKLENLSSLP 

       490        500        510        520        530        540 
PDSDRTSEVY LHEELQQDMQ KFKNEVNTLE EEFLALKKED VQLHKDVEEE MEKHRSNSTE 

       550        560        570        580        590        600 
LSGTLTDGTT VGNDDDGLNQ QIPRKENGEH DRPADKTSNE KNEVKNQIYP EADFADSMEP 

       610        620        630        640        650        660 
SEIASEDCEL SHSVYENFML LIEQLRMEYK DSASLPRIQD TFCLCEHLLK LKNNHCDQLT 

       670        680        690        700        710        720 
VKLKQMENMV SVLQNELSET KKTKLQLELQ KIEWEKELYD LRLALKQENE EKRNADMLYN 

       730        740        750        760        770        780 
KDSEQLRIKE EECGKVVETK QQLKWNLRRL VKELRTVRNN LDLVVQERND AQKQLSEEQD 

       790        800        810        820        830        840 
ARILQDQILT SKQKELEMAR KKMNSEISHR HQKEKDLFHE DCMLQEEIAL LRLEIDTIKN 

       850        860        870        880        890        900 
QNKQKEKKYF EDIEAVKEKN DNLQKIIKLN EETLTETILQ YSGQLNNLTA ENKILNSELE 

       910        920        930        940        950        960 
NGKQNQERLE IEMESYRCRL AAAVRDCDQS QTARDLKLDF QRTRQEWVRL HDKMKVDMSG 

       970        980        990       1000       1010       1020 
LQAKNEILSE KLSNAESKIN SLQIQLHNTR DALGRESLIL ERVQRDLSQT QCQKKETEQM 

      1030       1040       1050       1060       1070       1080 
YQIEQSKLKK YIAKQESVEE RLSQLQSENM LLRQQLDDAH KKANSQEKTS STIQDQFHSA 

      1090       1100       1110       1120       1130       1140 
AKNLQAESEK QILSLQEKNK ELMDEYNHLK ERMDQCEKEK AGRKIDLTEA QETVPSRCLH 

      1150       1160       1170       1180       1190       1200 
LDAENEVLQL QQTLFSMKAI QKQCETLQKN KKQLKQEVVN LKSYMERNML ERGKAEWHKL 

      1210       1220       1230       1240       1250       1260 
LIEERARKEI EEKLNEAILT LQKQAAVSHE QLVQLREDNT TSIKTQMELT IKDLESEISR 

      1270       1280       1290       1300       1310       1320 
IKTSQADFNK TELERYKELY LEEVKVRESL SNELSRTNEM IAEVSTQLTV EKEQTRSRSL 

      1330       1340       1350       1360       1370       1380 
FTAYATRPVL ESPCVGNLND SEGLNRKHIP RKKRSALKDM ESYLLKMQQK LQNDLTAEVA 

      1390       1400       1410       1420 
GSSQTGLHRI PQCSSFSSSS LHLLLCSICQ PFFLILQLLL NMNLDPI 

« Hide

Isoform 2 [UniParc].

Checksum: 7EC2982584939442
Show »

FASTA69181,413
Isoform 3 [UniParc].

Checksum: 0A3298D43B081F1D
Show »

FASTA1,154133,874

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[2]Ohara O., Nagase T., Ishikawa K.
Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[3]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 238-1410 (ISOFORM 3).
Tissue: Testis.
[6]"Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells."
Tan F., Lu L., Cai Y., Wang J., Xie Y., Wang L., Gong Y., Xu B.-E., Wu J., Luo Y., Qiang B., Yuan J., Sun X., Peng X.
Proteomics 8:2885-2896(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-955.
Tissue: Cervix carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB011137 mRNA. Translation: BAA25491.2. Sequence problems.
AC098850 Genomic DNA. No translation available.
BC133019 mRNA. Translation: AAI33020.1.
AK125971 mRNA. Translation: BAC86369.1. Frameshift.
RefSeqNP_055510.1. NM_014695.1.
UniGeneHs.745246.

3D structure databases

ProteinModelPortalA2RUR9.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115069. 1 interaction.
STRING9606.ENSP00000353717.

PTM databases

PhosphoSiteA2RUR9.

Proteomic databases

PaxDbA2RUR9.
PRIDEA2RUR9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000360524; ENSP00000353717; ENSG00000170160. [A2RUR9-1]
ENST00000443444; ENSP00000439262; ENSG00000170160. [A2RUR9-1]
ENST00000456009; ENSP00000394201; ENSG00000170160. [A2RUR9-3]
GeneID9720.
KEGGhsa:9720.
UCSCuc002gqk.1. human. [A2RUR9-1]

Organism-specific databases

CTD9720.
GeneCardsGC17P016592.
HGNCHGNC:29072. CCDC144A.
HPAHPA022996.
HPA023009.
HPA047851.
neXtProtNX_A2RUR9.
PharmGKBPA162381473.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG125406.
HOGENOMHOG000098303.
HOVERGENHBG107542.
InParanoidA2RUR9.
OMAIGHIFST.
PhylomeDBA2RUR9.
TreeFamTF342629.

Gene expression databases

BgeeA2RUR9.
GenevestigatorA2RUR9.

Family and domain databases

InterProIPR021885. DUF3496.
[Graphical view]
PfamPF12001. DUF3496. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi9720.
NextBio36553.
PROA2RUR9.

Entry information

Entry nameC144A_HUMAN
AccessionPrimary (citable) accession number: A2RUR9
Secondary accession number(s): O60311, Q6ZU57
Entry history
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 6, 2007
Last modified: April 16, 2014
This is version 56 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM