Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 144A

Gene

CCDC144A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 144A
Gene namesi
Name:CCDC144A
Synonyms:KIAA0565
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:29072. CCDC144A.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162381473.

Polymorphism and mutation databases

BioMutaiCCDC144A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14271427Coiled-coil domain-containing protein 144APRO_0000312279Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki955 – 955Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

PaxDbiA2RUR9.
PRIDEiA2RUR9.

PTM databases

PhosphoSiteiA2RUR9.

Expressioni

Gene expression databases

BgeeiA2RUR9.
ExpressionAtlasiA2RUR9. baseline.
GenevisibleiA2RUR9. HS.

Organism-specific databases

HPAiHPA022996.
HPA023009.
HPA047851.

Interactioni

Protein-protein interaction databases

BioGridi115069. 1 interaction.
STRINGi9606.ENSP00000353717.

Structurei

3D structure databases

ProteinModelPortaliA2RUR9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili490 – 54556Sequence AnalysisAdd
BLAST
Coiled coili648 – 1129482Sequence AnalysisAdd
BLAST
Coiled coili1155 – 1309155Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1394 – 14007Poly-Ser

Sequence similaritiesi

Belongs to the CCDC144 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG125406.
GeneTreeiENSGT00560000076605.
HOGENOMiHOG000098303.
HOVERGENiHBG107542.
InParanoidiA2RUR9.
OMAiKENGEHD.
PhylomeDBiA2RUR9.
TreeFamiTF342629.

Family and domain databases

InterProiIPR021885. DUF3496.
[Graphical view]
PfamiPF12001. DUF3496. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2RUR9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASWGGEKRG GAEGSPKPAV YATRKTPSVG SQGDQWYLGY PGDQWSSGFP
60 70 80 90 100
YSWWKNSVGS ESKHGEGALD QPQHDVRLED LGELHRAARS GDVPGVEHIL
110 120 130 140 150
APGDTGVDKR DRKKSIQQLV PEYKEKQTPE SLPQNNNPDW HPTNLTLSDE
160 170 180 190 200
TCQRSKNLKV DDKCPSVSPS MPENQSATKE LGQMNLTERE KMDTGVVLLS
210 220 230 240 250
GNDTLHDLCQ SQLPENKESK EAEQDSELTS EEEQERLKGC ENKQPQKTSQ
260 270 280 290 300
EPEMAKDCDR EDIPIYPVLP HVQKSEEMWI EQGKLEWKNQ LKLVINELKQ
310 320 330 340 350
RFGEIYEKYK IPACPEEEPL LDNSTRGTDV KDIPFNLTNN IPGCEEEDAS
360 370 380 390 400
EISVSVVFET FPEQKEPSLK NIIHPYYHPY SGSQEHVCQS SSKFHLHENK
410 420 430 440 450
LDCDNDNKPG IGHIFSTDKN FHNDASTKKA RNPEVVMVEM KEDQEFDLQM
460 470 480 490 500
TKNMNQNSDS GSTNNYKSLK PKLENLSSLP PDSDRTSEVY LHEELQQDMQ
510 520 530 540 550
KFKNEVNTLE EEFLALKKED VQLHKDVEEE MEKHRSNSTE LSGTLTDGTT
560 570 580 590 600
VGNDDDGLNQ QIPRKENGEH DRPADKTSNE KNEVKNQIYP EADFADSMEP
610 620 630 640 650
SEIASEDCEL SHSVYENFML LIEQLRMEYK DSASLPRIQD TFCLCEHLLK
660 670 680 690 700
LKNNHCDQLT VKLKQMENMV SVLQNELSET KKTKLQLELQ KIEWEKELYD
710 720 730 740 750
LRLALKQENE EKRNADMLYN KDSEQLRIKE EECGKVVETK QQLKWNLRRL
760 770 780 790 800
VKELRTVRNN LDLVVQERND AQKQLSEEQD ARILQDQILT SKQKELEMAR
810 820 830 840 850
KKMNSEISHR HQKEKDLFHE DCMLQEEIAL LRLEIDTIKN QNKQKEKKYF
860 870 880 890 900
EDIEAVKEKN DNLQKIIKLN EETLTETILQ YSGQLNNLTA ENKILNSELE
910 920 930 940 950
NGKQNQERLE IEMESYRCRL AAAVRDCDQS QTARDLKLDF QRTRQEWVRL
960 970 980 990 1000
HDKMKVDMSG LQAKNEILSE KLSNAESKIN SLQIQLHNTR DALGRESLIL
1010 1020 1030 1040 1050
ERVQRDLSQT QCQKKETEQM YQIEQSKLKK YIAKQESVEE RLSQLQSENM
1060 1070 1080 1090 1100
LLRQQLDDAH KKANSQEKTS STIQDQFHSA AKNLQAESEK QILSLQEKNK
1110 1120 1130 1140 1150
ELMDEYNHLK ERMDQCEKEK AGRKIDLTEA QETVPSRCLH LDAENEVLQL
1160 1170 1180 1190 1200
QQTLFSMKAI QKQCETLQKN KKQLKQEVVN LKSYMERNML ERGKAEWHKL
1210 1220 1230 1240 1250
LIEERARKEI EEKLNEAILT LQKQAAVSHE QLVQLREDNT TSIKTQMELT
1260 1270 1280 1290 1300
IKDLESEISR IKTSQADFNK TELERYKELY LEEVKVRESL SNELSRTNEM
1310 1320 1330 1340 1350
IAEVSTQLTV EKEQTRSRSL FTAYATRPVL ESPCVGNLND SEGLNRKHIP
1360 1370 1380 1390 1400
RKKRSALKDM ESYLLKMQQK LQNDLTAEVA GSSQTGLHRI PQCSSFSSSS
1410 1420
LHLLLCSICQ PFFLILQLLL NMNLDPI
Length:1,427
Mass (Da):165,125
Last modified:March 6, 2007 - v1
Checksum:i9538A4F523D8D5C5
GO
Isoform 2 (identifier: A2RUR9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-697: Missing.
     698-701: LYDL → MFNC
     1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

Note: No experimental confirmation available.
Show »
Length:691
Mass (Da):81,413
Checksum:i7EC2982584939442
GO
Isoform 3 (identifier: A2RUR9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-526: Missing.
     1124-1124: K → KVVMREFQQEWTDLLKQQPTSEATSRCHINLDETQDSKKKLGQIRSE
     1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

Show »
Length:1,154
Mass (Da):133,874
Checksum:i0A3298D43B081F1D
GO

Sequence cautioni

The sequence BAA25491.2 differs from that shown. Reason: Frameshift at position 1322. Curated
The sequence BAA25491.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC86369.1 differs from that shown. Reason: Frameshift at position 953. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1085 – 10851Q → R in BAC86369 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 697697Missing in isoform 2. 1 PublicationVSP_029787Add
BLAST
Alternative sequencei247 – 526280Missing in isoform 3. 1 PublicationVSP_029788Add
BLAST
Alternative sequencei698 – 7014LYDL → MFNC in isoform 2. 1 PublicationVSP_029789
Alternative sequencei1124 – 11241K → KVVMREFQQEWTDLLKQQPT SEATSRCHINLDETQDSKKK LGQIRSE in isoform 3. 1 PublicationVSP_029790
Alternative sequencei1367 – 142761MQQKL…NLDPI → VSYLFSFGVQISDRILVCYL VK in isoform 2 and isoform 3. 2 PublicationsVSP_029791Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011137 mRNA. Translation: BAA25491.2. Sequence problems.
AC098850 Genomic DNA. No translation available.
BC133019 mRNA. Translation: AAI33020.1.
AK125971 mRNA. Translation: BAC86369.1. Frameshift.
CCDSiCCDS45621.1. [A2RUR9-1]
RefSeqiNP_055510.1. NM_014695.2. [A2RUR9-1]
UniGeneiHs.745246.

Genome annotation databases

EnsembliENST00000360524; ENSP00000353717; ENSG00000170160. [A2RUR9-1]
GeneIDi9720.
KEGGihsa:9720.
UCSCiuc002gqk.1. human. [A2RUR9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011137 mRNA. Translation: BAA25491.2. Sequence problems.
AC098850 Genomic DNA. No translation available.
BC133019 mRNA. Translation: AAI33020.1.
AK125971 mRNA. Translation: BAC86369.1. Frameshift.
CCDSiCCDS45621.1. [A2RUR9-1]
RefSeqiNP_055510.1. NM_014695.2. [A2RUR9-1]
UniGeneiHs.745246.

3D structure databases

ProteinModelPortaliA2RUR9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115069. 1 interaction.
STRINGi9606.ENSP00000353717.

PTM databases

PhosphoSiteiA2RUR9.

Polymorphism and mutation databases

BioMutaiCCDC144A.

Proteomic databases

PaxDbiA2RUR9.
PRIDEiA2RUR9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360524; ENSP00000353717; ENSG00000170160. [A2RUR9-1]
GeneIDi9720.
KEGGihsa:9720.
UCSCiuc002gqk.1. human. [A2RUR9-1]

Organism-specific databases

CTDi9720.
GeneCardsiGC17P016592.
HGNCiHGNC:29072. CCDC144A.
HPAiHPA022996.
HPA023009.
HPA047851.
neXtProtiNX_A2RUR9.
PharmGKBiPA162381473.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG125406.
GeneTreeiENSGT00560000076605.
HOGENOMiHOG000098303.
HOVERGENiHBG107542.
InParanoidiA2RUR9.
OMAiKENGEHD.
PhylomeDBiA2RUR9.
TreeFamiTF342629.

Miscellaneous databases

GenomeRNAii9720.
NextBioi36553.
PROiA2RUR9.

Gene expression databases

BgeeiA2RUR9.
ExpressionAtlasiA2RUR9. baseline.
GenevisibleiA2RUR9. HS.

Family and domain databases

InterProiIPR021885. DUF3496.
[Graphical view]
PfamiPF12001. DUF3496. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. Ohara O., Nagase T., Ishikawa K.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 238-1410 (ISOFORM 3).
    Tissue: Testis.
  6. "Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells."
    Tan F., Lu L., Cai Y., Wang J., Xie Y., Wang L., Gong Y., Xu B.-E., Wu J., Luo Y., Qiang B., Yuan J., Sun X., Peng X.
    Proteomics 8:2885-2896(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-955.
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiC144A_HUMAN
AccessioniPrimary (citable) accession number: A2RUR9
Secondary accession number(s): O60311, Q6ZU57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 6, 2007
Last modified: June 24, 2015
This is version 64 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.