Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 27

Gene

WDR27

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

SignaLinkiA2RRH5.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 27
Gene namesi
Name:WDR27
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000184465.15.
HGNCiHGNC:21248. WDR27.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi253769.
OpenTargetsiENSG00000184465.
PharmGKBiPA134875091.

Polymorphism and mutation databases

BioMutaiWDR27.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003068311 – 827WD repeat-containing protein 27Add BLAST827

Proteomic databases

PaxDbiA2RRH5.
PRIDEiA2RRH5.
TopDownProteomicsiA2RRH5-2. [A2RRH5-2]

PTM databases

iPTMnetiA2RRH5.
PhosphoSitePlusiA2RRH5.

Expressioni

Gene expression databases

BgeeiENSG00000184465.
CleanExiHS_WDR27.
ExpressionAtlasiA2RRH5. baseline and differential.
GenevisibleiA2RRH5. HS.

Organism-specific databases

HPAiHPA037497.
HPA037498.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ASNSP082433EBI-9476803,EBI-722989

Protein-protein interaction databases

BioGridi128986. 2 interactors.
IntActiA2RRH5. 2 interactors.
STRINGi9606.ENSP00000416289.

Structurei

3D structure databases

ProteinModelPortaliA2RRH5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati26 – 65WD 1Add BLAST40
Repeati69 – 109WD 2Add BLAST41
Repeati162 – 202WD 3Add BLAST41
Repeati206 – 245WD 4Add BLAST40
Repeati511 – 550WD 5Add BLAST40
Repeati553 – 592WD 6Add BLAST40
Repeati655 – 695WD 7Add BLAST41
Repeati699 – 748WD 8Add BLAST50
Repeati753 – 792WD 9Add BLAST40
Repeati795 – 827WD 10Add BLAST33

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQ0V. Eukaryota.
ENOG410XYX9. LUCA.
GeneTreeiENSGT00390000012017.
HOGENOMiHOG000154847.
HOVERGENiHBG108668.
InParanoidiA2RRH5.
OMAiFSGHDGA.
OrthoDBiEOG091G07QE.
PhylomeDBiA2RRH5.
TreeFamiTF351563.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiView protein in InterPro
IPR011047. Quinoprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom_sf.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
PfamiView protein in Pfam
PF00400. WD40. 5 hits.
SMARTiView protein in SMART
SM00320. WD40. 10 hits.
SUPFAMiSSF50998. SSF50998. 3 hits.
PROSITEiView protein in PROSITE
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2RRH5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENPQDIFSS NGGCLSDIVI EKYLVESKES VSHVQLACSM QDCAFPLDGT
60 70 80 90 100
ELCIWNTKDP SHQLLILRGH HQPITAMAFG NKVNPLLICS ASLDYVIMWN
110 120 130 140 150
LDECREKVLQ GLVPRGTVMG SLLGKVLCLQ LSLDDHVVAV CAGNKIFMLD
160 170 180 190 200
IETQAVRAEL QGHLGPVTAV EFCPWRAGTL ISASEDRGFK VWDHCTGSLI
210 220 230 240 250
YSSSVLSAYP LLSLFIDAES RQLVTGCADG QLWIFSLMDG HHYRRVARVD
260 270 280 290 300
LRKKTETFST RRVKSGLCSQ PEESQLPSTS ALGKGEQVEV TFPVLRLAPC
310 320 330 340 350
DLSLIPNSAC GCLSSENTRC VWIGSSVGLF VFNLANLEVE AALYYKDFQS
360 370 380 390 400
LSILLAGSCA LRNRTADQKV LCLLASLFGG KIAVLEINPA ALVRAQQCPS
410 420 430 440 450
MGQSLSVPAS SCVLPTSPLY LGIAKEKSTK AASEQRRAAR NVMKDQRLVF
460 470 480 490 500
HSKVRSSGYA SAPHVTMFSP KTNIKSEGKG SSRSRSSCAR EAYPVECAVP
510 520 530 540 550
TKPGPQVAAA PTCTRVCCIQ YSGDGQWLAC GLANHLLLVF DASLTGTPAV
560 570 580 590 600
FSGHDGAVNA VCWSQDRRWL LSAARDGTLR MWSARGAELA LLLGKDMFSK
610 620 630 640 650
PIQSAQFYYI DAFILLSSGP EFQLLRYHID TCKDEIKRYK QKSKSKLICR
660 670 680 690 700
LSTTGAVDMT SLSAVNDFYS HIVLAAGRNR TVEVFDLNAG CSAAVIAEAH
710 720 730 740 750
SRPVHQICQN KGSSFTTQQP QAYNLFLTTA IGDGMRLWDL RTLRCERHFE
760 770 780 790 800
GHPTRGYPCG IAFSPCGRFA ACGAEDRHAY VYEMGSSTFS HRLAGHTDTV
810 820
TGVAFNPSAP QLATATLDGK LQLFLAE
Length:827
Mass (Da):90,038
Last modified:April 5, 2011 - v3
Checksum:i932404623943AC4C
GO
Isoform 2 (identifier: A2RRH5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-207: Missing.

Show »
Length:730
Mass (Da):79,712
Checksum:i58ECDFE7DD65F7DF
GO
Isoform 3 (identifier: A2RRH5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-112: GL → GK
     113-827: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,522
Checksum:i6A21DD6CDF3ABB66
GO
Isoform 4 (identifier: A2RRH5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: E → EQRFSVTYIERPDVNNRHKVPPPTFLHTFSQ
     812-827: LATATLDGKLQLFLAE → MESRSVAHAGVQWHDLGSLQPPPSRFKQFFCLSLPSSWDYSLPQLPWMVNSSSF

Note: No experimental confirmation available.Curated
Show »
Length:895
Mass (Da):98,096
Checksum:i0D5437DD99F4BD37
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti153T → A in BC040606 (PubMed:15489334).Curated1
Sequence conflicti512T → S in AAI31634 (PubMed:15489334).Curated1
Sequence conflicti512T → S in AAI42983 (PubMed:15489334).Curated1
Isoform 4 (identifier: A2RRH5-4)
Sequence conflicti845R → C in BC040606 (PubMed:15489334).Curated1
Sequence conflicti875L → F in BC040606 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035317133L → P1 PublicationCorresponds to variant dbSNP:rs4236176Ensembl.1
Natural variantiVAR_035318393V → L. Corresponds to variant dbSNP:rs35895089Ensembl.1
Natural variantiVAR_035319437R → H1 PublicationCorresponds to variant dbSNP:rs3800544Ensembl.1
Natural variantiVAR_035320470P → L. Corresponds to variant dbSNP:rs34313252Ensembl.1
Natural variantiVAR_035321697A → V. Corresponds to variant dbSNP:rs9396946Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_028510111 – 207Missing in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_028511111 – 112GL → GK in isoform 3. 1 Publication2
Alternative sequenceiVSP_028512113 – 827Missing in isoform 3. 1 PublicationAdd BLAST715
Alternative sequenceiVSP_040796152E → EQRFSVTYIERPDVNNRHKV PPPTFLHTFSQ in isoform 4. 1 Publication1
Alternative sequenceiVSP_040797812 – 827LATAT…LFLAE → MESRSVAHAGVQWHDLGSLQ PPPSRFKQFFCLSLPSSWDY SLPQLPWMVNSSSF in isoform 4. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL031315 Genomic DNA. No translation available.
AL135910 Genomic DNA. No translation available.
AL441927 Genomic DNA. No translation available.
AL513547 Genomic DNA. Translation: CAI12313.1.
BC040606 mRNA. No translation available.
BC131633 mRNA. Translation: AAI31634.1.
BC142982 mRNA. Translation: AAI42983.1.
CCDSiCCDS47520.2. [A2RRH5-4]
CCDS56459.1. [A2RRH5-2]
RefSeqiNP_001189479.1. NM_001202550.1. [A2RRH5-2]
NP_872358.4. NM_182552.4. [A2RRH5-4]
UniGeneiHs.131903.

Genome annotation databases

EnsembliENST00000423258; ENSP00000397869; ENSG00000184465. [A2RRH5-2]
ENST00000448612; ENSP00000416289; ENSG00000184465. [A2RRH5-4]
GeneIDi253769.
KEGGihsa:253769.
UCSCiuc003qwx.4. human. [A2RRH5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiWDR27_HUMAN
AccessioniPrimary (citable) accession number: A2RRH5
Secondary accession number(s): A5PLM8, C9JGV0, Q5T066
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: April 5, 2011
Last modified: November 22, 2017
This is version 91 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations