Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 27

Gene

WDR27

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

SignaLinkiA2RRH5.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 27
Gene namesi
Name:WDR27
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21248. WDR27.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134875091.

Polymorphism and mutation databases

BioMutaiWDR27.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 827827WD repeat-containing protein 27PRO_0000306831Add
BLAST

Proteomic databases

PaxDbiA2RRH5.
PRIDEiA2RRH5.
TopDownProteomicsiA2RRH5-2. [A2RRH5-2]

PTM databases

iPTMnetiA2RRH5.
PhosphoSiteiA2RRH5.

Expressioni

Gene expression databases

BgeeiA2RRH5.
CleanExiHS_WDR27.
ExpressionAtlasiA2RRH5. baseline and differential.
GenevisibleiA2RRH5. HS.

Organism-specific databases

HPAiHPA037497.
HPA037498.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ASNSP082433EBI-9476803,EBI-722989

Protein-protein interaction databases

BioGridi128986. 2 interactions.
IntActiA2RRH5. 2 interactions.
STRINGi9606.ENSP00000416289.

Structurei

3D structure databases

ProteinModelPortaliA2RRH5.
SMRiA2RRH5. Positions 154-237, 516-818.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati26 – 6540WD 1Add
BLAST
Repeati69 – 10941WD 2Add
BLAST
Repeati162 – 20241WD 3Add
BLAST
Repeati206 – 24540WD 4Add
BLAST
Repeati511 – 55040WD 5Add
BLAST
Repeati553 – 59240WD 6Add
BLAST
Repeati655 – 69541WD 7Add
BLAST
Repeati699 – 74850WD 8Add
BLAST
Repeati753 – 79240WD 9Add
BLAST
Repeati795 – 82733WD 10Add
BLAST

Sequence similaritiesi

Contains 10 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQ0V. Eukaryota.
ENOG410XYX9. LUCA.
GeneTreeiENSGT00390000012017.
HOGENOMiHOG000154847.
HOVERGENiHBG108668.
InParanoidiA2RRH5.
OMAiPVHQICQ.
OrthoDBiEOG7SXW2Q.
PhylomeDBiA2RRH5.
TreeFamiTF351563.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR011047. Quinoprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00320. WD40. 10 hits.
[Graphical view]
SUPFAMiSSF50998. SSF50998. 3 hits.
PROSITEiPS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2RRH5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENPQDIFSS NGGCLSDIVI EKYLVESKES VSHVQLACSM QDCAFPLDGT
60 70 80 90 100
ELCIWNTKDP SHQLLILRGH HQPITAMAFG NKVNPLLICS ASLDYVIMWN
110 120 130 140 150
LDECREKVLQ GLVPRGTVMG SLLGKVLCLQ LSLDDHVVAV CAGNKIFMLD
160 170 180 190 200
IETQAVRAEL QGHLGPVTAV EFCPWRAGTL ISASEDRGFK VWDHCTGSLI
210 220 230 240 250
YSSSVLSAYP LLSLFIDAES RQLVTGCADG QLWIFSLMDG HHYRRVARVD
260 270 280 290 300
LRKKTETFST RRVKSGLCSQ PEESQLPSTS ALGKGEQVEV TFPVLRLAPC
310 320 330 340 350
DLSLIPNSAC GCLSSENTRC VWIGSSVGLF VFNLANLEVE AALYYKDFQS
360 370 380 390 400
LSILLAGSCA LRNRTADQKV LCLLASLFGG KIAVLEINPA ALVRAQQCPS
410 420 430 440 450
MGQSLSVPAS SCVLPTSPLY LGIAKEKSTK AASEQRRAAR NVMKDQRLVF
460 470 480 490 500
HSKVRSSGYA SAPHVTMFSP KTNIKSEGKG SSRSRSSCAR EAYPVECAVP
510 520 530 540 550
TKPGPQVAAA PTCTRVCCIQ YSGDGQWLAC GLANHLLLVF DASLTGTPAV
560 570 580 590 600
FSGHDGAVNA VCWSQDRRWL LSAARDGTLR MWSARGAELA LLLGKDMFSK
610 620 630 640 650
PIQSAQFYYI DAFILLSSGP EFQLLRYHID TCKDEIKRYK QKSKSKLICR
660 670 680 690 700
LSTTGAVDMT SLSAVNDFYS HIVLAAGRNR TVEVFDLNAG CSAAVIAEAH
710 720 730 740 750
SRPVHQICQN KGSSFTTQQP QAYNLFLTTA IGDGMRLWDL RTLRCERHFE
760 770 780 790 800
GHPTRGYPCG IAFSPCGRFA ACGAEDRHAY VYEMGSSTFS HRLAGHTDTV
810 820
TGVAFNPSAP QLATATLDGK LQLFLAE
Length:827
Mass (Da):90,038
Last modified:April 5, 2011 - v3
Checksum:i932404623943AC4C
GO
Isoform 2 (identifier: A2RRH5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-207: Missing.

Show »
Length:730
Mass (Da):79,712
Checksum:i58ECDFE7DD65F7DF
GO
Isoform 3 (identifier: A2RRH5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-112: GL → GK
     113-827: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,522
Checksum:i6A21DD6CDF3ABB66
GO
Isoform 4 (identifier: A2RRH5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: E → EQRFSVTYIERPDVNNRHKVPPPTFLHTFSQ
     812-827: LATATLDGKLQLFLAE → MESRSVAHAGVQWHDLGSLQPPPSRFKQFFCLSLPSSWDYSLPQLPWMVNSSSF

Note: No experimental confirmation available.Curated
Show »
Length:895
Mass (Da):98,096
Checksum:i0D5437DD99F4BD37
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti153 – 1531T → A in BC040606 (PubMed:15489334).Curated
Sequence conflicti512 – 5121T → S in AAI31634 (PubMed:15489334).Curated
Sequence conflicti512 – 5121T → S in AAI42983 (PubMed:15489334).Curated
Isoform 4 (identifier: A2RRH5-4)
Sequence conflicti845 – 8451R → C in BC040606 (PubMed:15489334).Curated
Sequence conflicti875 – 8751L → F in BC040606 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti133 – 1331L → P.1 Publication
Corresponds to variant rs4236176 [ dbSNP | Ensembl ].
VAR_035317
Natural varianti393 – 3931V → L.
Corresponds to variant rs35895089 [ dbSNP | Ensembl ].
VAR_035318
Natural varianti437 – 4371R → H.1 Publication
Corresponds to variant rs3800544 [ dbSNP | Ensembl ].
VAR_035319
Natural varianti470 – 4701P → L.
Corresponds to variant rs34313252 [ dbSNP | Ensembl ].
VAR_035320
Natural varianti697 – 6971A → V.
Corresponds to variant rs9396946 [ dbSNP | Ensembl ].
VAR_035321

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei111 – 20797Missing in isoform 2. 1 PublicationVSP_028510Add
BLAST
Alternative sequencei111 – 1122GL → GK in isoform 3. 1 PublicationVSP_028511
Alternative sequencei113 – 827715Missing in isoform 3. 1 PublicationVSP_028512Add
BLAST
Alternative sequencei152 – 1521E → EQRFSVTYIERPDVNNRHKV PPPTFLHTFSQ in isoform 4. 1 PublicationVSP_040796
Alternative sequencei812 – 82716LATAT…LFLAE → MESRSVAHAGVQWHDLGSLQ PPPSRFKQFFCLSLPSSWDY SLPQLPWMVNSSSF in isoform 4. 1 PublicationVSP_040797Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL031315 Genomic DNA. No translation available.
AL135910 Genomic DNA. No translation available.
AL441927 Genomic DNA. No translation available.
AL513547 Genomic DNA. Translation: CAI12313.1.
BC040606 mRNA. No translation available.
BC131633 mRNA. Translation: AAI31634.1.
BC142982 mRNA. Translation: AAI42983.1.
CCDSiCCDS47520.2. [A2RRH5-4]
CCDS56459.1. [A2RRH5-2]
RefSeqiNP_001189479.1. NM_001202550.1. [A2RRH5-2]
NP_872358.4. NM_182552.4. [A2RRH5-4]
UniGeneiHs.131903.

Genome annotation databases

EnsembliENST00000423258; ENSP00000397869; ENSG00000184465. [A2RRH5-2]
ENST00000448612; ENSP00000416289; ENSG00000184465. [A2RRH5-4]
GeneIDi253769.
KEGGihsa:253769.
UCSCiuc003qwx.4. human. [A2RRH5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL031315 Genomic DNA. No translation available.
AL135910 Genomic DNA. No translation available.
AL441927 Genomic DNA. No translation available.
AL513547 Genomic DNA. Translation: CAI12313.1.
BC040606 mRNA. No translation available.
BC131633 mRNA. Translation: AAI31634.1.
BC142982 mRNA. Translation: AAI42983.1.
CCDSiCCDS47520.2. [A2RRH5-4]
CCDS56459.1. [A2RRH5-2]
RefSeqiNP_001189479.1. NM_001202550.1. [A2RRH5-2]
NP_872358.4. NM_182552.4. [A2RRH5-4]
UniGeneiHs.131903.

3D structure databases

ProteinModelPortaliA2RRH5.
SMRiA2RRH5. Positions 154-237, 516-818.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128986. 2 interactions.
IntActiA2RRH5. 2 interactions.
STRINGi9606.ENSP00000416289.

PTM databases

iPTMnetiA2RRH5.
PhosphoSiteiA2RRH5.

Polymorphism and mutation databases

BioMutaiWDR27.

Proteomic databases

PaxDbiA2RRH5.
PRIDEiA2RRH5.
TopDownProteomicsiA2RRH5-2. [A2RRH5-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000423258; ENSP00000397869; ENSG00000184465. [A2RRH5-2]
ENST00000448612; ENSP00000416289; ENSG00000184465. [A2RRH5-4]
GeneIDi253769.
KEGGihsa:253769.
UCSCiuc003qwx.4. human. [A2RRH5-1]

Organism-specific databases

CTDi253769.
GeneCardsiWDR27.
HGNCiHGNC:21248. WDR27.
HPAiHPA037497.
HPA037498.
neXtProtiNX_A2RRH5.
PharmGKBiPA134875091.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQ0V. Eukaryota.
ENOG410XYX9. LUCA.
GeneTreeiENSGT00390000012017.
HOGENOMiHOG000154847.
HOVERGENiHBG108668.
InParanoidiA2RRH5.
OMAiPVHQICQ.
OrthoDBiEOG7SXW2Q.
PhylomeDBiA2RRH5.
TreeFamiTF351563.

Enzyme and pathway databases

SignaLinkiA2RRH5.

Miscellaneous databases

ChiTaRSiWDR27. human.
GenomeRNAii253769.
NextBioi92163.
PROiA2RRH5.

Gene expression databases

BgeeiA2RRH5.
CleanExiHS_WDR27.
ExpressionAtlasiA2RRH5. baseline and differential.
GenevisibleiA2RRH5. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR011047. Quinoprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00320. WD40. 10 hits.
[Graphical view]
SUPFAMiSSF50998. SSF50998. 3 hits.
PROSITEiPS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), VARIANTS PRO-133 AND HIS-437.

Entry informationi

Entry nameiWDR27_HUMAN
AccessioniPrimary (citable) accession number: A2RRH5
Secondary accession number(s): A5PLM8, C9JGV0, Q5T066
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: April 5, 2011
Last modified: May 11, 2016
This is version 81 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.