Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAX gene-associated protein

Gene

Mga

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi84 – 260177T-boxPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
MAX gene-associated protein
Gene namesi
Name:Mga
Synonyms:Kiaa4252
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1352483. Mga.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • MLL1 complex Source: UniProtKB
  • nucleoplasm Source: MGI
  • transcription factor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 30033003MAX gene-associated proteinPRO_0000342693Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki329 – 329Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki458 – 458Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei531 – 5311PhosphoserineBy similarity
Cross-linki567 – 567Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei921 – 9211PhosphoserineBy similarity
Cross-linki1202 – 1202Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1423 – 14231PhosphoserineBy similarity
Modified residuei1450 – 14501PhosphoserineBy similarity
Cross-linki1937 – 1937Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2060 – 2060Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2179 – 2179Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2225 – 2225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2352 – 2352Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei2480 – 24801PhosphoserineBy similarity
Modified residuei2849 – 28491PhosphoserineBy similarity
Modified residuei2860 – 28601PhosphoserineBy similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiA2AWL7.
MaxQBiA2AWL7.
PaxDbiA2AWL7.
PRIDEiA2AWL7.

PTM databases

iPTMnetiA2AWL7.
PhosphoSiteiA2AWL7.

Expressioni

Developmental stagei

Expressed at E9.5, E10 and E10.5 in the limb buds, branchial arches and the tail region.

Gene expression databases

BgeeiA2AWL7.
ExpressionAtlasiA2AWL7. baseline and differential.
GenevisibleiA2AWL7. MM.

Interactioni

Subunit structurei

Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with ZMYND11 (By similarity). Interacts with MAX. Requires heterodimerization with MAX for E-box binding.By similarity

Protein-protein interaction databases

BioGridi205889. 6 interactions.
IntActiA2AWL7. 5 interactions.
STRINGi10090.ENSMUSP00000106401.

Structurei

3D structure databases

ProteinModelPortaliA2AWL7.
SMRiA2AWL7. Positions 75-259.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2362 – 241352bHLHPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi688 – 6914Poly-Thr
Compositional biasi1634 – 170572Thr-richAdd
BLAST
Compositional biasi1800 – 184748Ser-richAdd
BLAST
Compositional biasi2998 – 30014Poly-Ser

Domaini

Transcription repression is enhanced or dependent on the presence of the T-box DNA-binding domain.

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation
Contains 1 T-box DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3585. Eukaryota.
ENOG410XSTS. LUCA.
GeneTreeiENSGT00740000115029.
HOVERGENiHBG108131.
InParanoidiA2AWL7.
OrthoDBiEOG7S7SCT.
PhylomeDBiA2AWL7.

Family and domain databases

Gene3Di2.60.40.820. 1 hit.
4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR032060. DUF4801.
IPR008967. p53-like_TF_DNA-bd.
IPR001699. TF_T-box.
IPR018186. TF_T-box_CS.
[Graphical view]
PANTHERiPTHR11267. PTHR11267. 1 hit.
PfamiPF16059. DUF4801. 1 hit.
PF00010. HLH. 1 hit.
PF00907. T-box. 1 hit.
[Graphical view]
PRINTSiPR00937. TBOX.
SMARTiSM00353. HLH. 1 hit.
SM00425. TBOX. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
SSF49417. SSF49417. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
PS01264. TBOX_2. 1 hit.
PS50252. TBOX_3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A2AWL7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEKQQIILA NQDGGTVTGG APTFFVILKQ PGNGKTDQGI LVTNRDARAL
60 70 80 90 100
LSRESSPGKS KEKICLPADC TVGKITVTLD NNSMWNEFHN RSTEMILTKQ
110 120 130 140 150
GRRMFPYCRY WITGLDSNLK YILVMDISPV DSHRYKWNGR WWEPSGKAEP
160 170 180 190 200
HILGRVFIHP ESPSTGHYWM HQPVSFYKLK LTNNTLDQEG HIILHSMHRY
210 220 230 240 250
LPRLHLVPAE KATEVIQLNG PGVHTFTFPQ TEFFAVTAYQ NIQITQLKID
260 270 280 290 300
YNPFAKGFRD DGLSSKPQRE GKQRNSSDQE GNSVSSSPAH RVRLTEGEGS
310 320 330 340 350
EIHSGDFDPV LRGHEASSLS LEKAPHNVKQ DFLGFMNTDS THEVPQLKHE
360 370 380 390 400
ISESRIVNSF EDDSQISSPS NPNGNFNVVI KEEPLDDYDY ELGECPEGIT
410 420 430 440 450
VKQEETDEET DVYSNSDDDP ILEKQLKRHN KVDNLEADHP SYKWLPNSPG
460 470 480 490 500
VAKAKMFKLD AGKMPVVYLE PCAVTKSTVK ISELPDNMLS TSRKDKSMLA
510 520 530 540 550
ELEYLPAYIE NSDGTDFCLS KDSENSLRKH SPDLRIVQKY TLLKEPNWKY
560 570 580 590 600
PDILDNSSTE RIHDSSKGST AESFSGKEDL GKKRTTMLKM AIPSKTVTAS
610 620 630 640 650
HSASPNTPGK RGRPRKLRLS KAGRPPKNTG KSLTAAKNIP VGPGSTFPDV
660 670 680 690 700
KPDLEDVDGV LFVSFESKEA LDIHAVDGTT EEPSSLQTTT TNDSGCRTRI
710 720 730 740 750
SQLEKELIED LKSLRHKQVI HPALQEVGLK LNSVDPTVSI DLKYLGVQLP
760 770 780 790 800
LAPATSFPLW NVTGTNPASP DAGFPFVSRT GKTNDFTKIK GWRGKFQNAS
810 820 830 840 850
ASRNEGGNSE ASLKNRSAFC SDKLDEYLEN EGKLMETNIG FSSNAPTSPV
860 870 880 890 900
VYQLPTKSTS YVRTLDSVLK KQSTISPSTS HSVKPQSVTT ASRKTKAQNK
910 920 930 940 950
QTTLSGRTKS SYKSILPYPV SPKQKNSHVS QGDKITKNSL SSTSDNQVTN
960 970 980 990 1000
LVVPSVDENA FPKQISLRQA QQQHLQQQGT RPPGLSKSQV KLMDLEDCAL
1010 1020 1030 1040 1050
WEGKPRTYIT EERADVSLTT LLTAQASLKT KPIHTIIRKR APPCNNDFCR
1060 1070 1080 1090 1100
LGCVCSSLAL EKRQPAHCRR PDCMFGCTCL KRKVVLVKGG SKTKHFHKKA
1110 1120 1130 1140 1150
ANRDPLFYDT LGEEGREGGG VREDEEQLKE KKKRKKLEYT VCEAEPEQPV
1160 1170 1180 1190 1200
RHYPLWVKVE GEVDPEPVYI PTPSVIEPIK PLVLPQPDLS STTKGKLTPG
1210 1220 1230 1240 1250
IKPARTYTPK PNPVIREEDK DPVYLYFESM MTCARVRVYE RKKEEQRQLS
1260 1270 1280 1290 1300
PPLSPSSSFQ QQSSCYSSPE NRVTKELDSE QTLKQLICDL EDDSDKSQEK
1310 1320 1330 1340 1350
SWKSSCNEGE SSSTSYVHQR SPGGPTKLIE IISDCNWEED RNKILSILSQ
1360 1370 1380 1390 1400
HINSNMPQSL KVGSFIIELA SQRKCRGEKT PPVYSSRVKI SMPSSQDQDD
1410 1420 1430 1440 1450
MAEKSGSETP DGPLSPGKMD DISPVQTDAL DSVRERLHGG KGLPFYAGLS
1460 1470 1480 1490 1500
PSGKLVAYKR KPSSTTSGLI QVASNAKVAA SRKPRTLLPS TSNSKMASSG
1510 1520 1530 1540 1550
PATNRSGKNL KAFVPAKRPI AARPSPGGVF TQFVMSKVGA LQQKIPGVRT
1560 1570 1580 1590 1600
PQPLTGPQKF SIRPSPVMVV TPVVSSEQVQ VCSTVAAAVT TSPQVFLENV
1610 1620 1630 1640 1650
TAVPSLTANS DMGAKEATYS SSASTAGVVE ISETNNTTLV TSTQSTATVN
1660 1670 1680 1690 1700
LTKTTGITTS PVASVSFAKP LVASPTITLP VASTASTSIV MVTTAASSSV
1710 1720 1730 1740 1750
VTTPTSSLSS VPIILSGING SPPVSQRPEN APQIPVTTPQ ISSNNVKRTG
1760 1770 1780 1790 1800
PRLLHPNGQI VQLLPLHQIR GSNAQPSLQP VVFRNPGSMV GIRLPAPCKS
1810 1820 1830 1840 1850
SETPSSSASS SAFSVMSPVI QAVGSSPTVN VISQAPSLLS SGSSFVSQAG
1860 1870 1880 1890 1900
TLTLRISPPE TQNLASKTGS ESKITPSTGG QPVGTASLIP LQSGSFALLQ
1910 1920 1930 1940 1950
LPGQKPIPSS VLQHVASLQI KKESQSTDQK DETNSIKREE ETKKALPSKD
1960 1970 1980 1990 2000
KALDSEANIM KQNSGIIASE NTSNNSLDDG GDLLDEETLR EDARPYEYSY
2010 2020 2030 2040 2050
STGSHTDEDK DGDEDSGNKN QNSPKEKQTV PEVRAGSKNI DIMALQSIRS
2060 2070 2080 2090 2100
IRPQKCVKVK VEPQEGSDNP ENPDDFLVLS KDSKFELSGN QVKEQQSNSQ
2110 2120 2130 2140 2150
AEAKKDCEDS LGKDSLRERW RKHLKGPLTQ KYIGISQNFN KEANVQFFTE
2160 2170 2180 2190 2200
MKPCQENSEQ DISELLGKSG TIESGGVLKT EDGSWSGISS SAAFSIIPRR
2210 2220 2230 2240 2250
ATKGRRGSRH FQGHLLLPRE QMKPKQQTKD GRSSAADFTV LDLEDEDEED
2260 2270 2280 2290 2300
EKTDDSLDEI VDVVSGYQSE EVDVEKNNYV DYLEDDEQVD VETIEELSEE
2310 2320 2330 2340 2350
INFPYKKTTA THTQSFKQQC HSHISADEKA SEKSRKVSLI SSKLKDDCWG
2360 2370 2380 2390 2400
DKPHKETEAF AYYRRTHTAN ERRRRGEMRD LFEKLKITLG LLHSSKVSKS
2410 2420 2430 2440 2450
LILNRAFSEI QGLTDQADKL IGQKNLLSRK RSILIRKVSS LSGKTEEVVL
2460 2470 2480 2490 2500
KKLEYIYAKQ QALEAQKRKK KLGSDEFCVS PRIGTQLEGS SASSVDLGQM
2510 2520 2530 2540 2550
LMNNRRGKPL ILSRKRDQAT ENASPSDTPH SSANLVMTPQ GQLLTLKGPL
2560 2570 2580 2590 2600
FSGPVVAVSP ALLEGGLKPQ VASSTMSQSE NDDLFMMPRI VNVTSLAAEE
2610 2620 2630 2640 2650
DLGGMSGNKY RHEVPDGKPL DHLRDIAGSE ASSLKDTERI SSRGNHRDSR
2660 2670 2680 2690 2700
KALGPTQVLL ANKDSGFPHV ADVSTMQAAQ EFIPKNMSGD VRGHRYKWKE
2710 2720 2730 2740 2750
CELRGERLKS KESQFHKLKM KDLKDSSIEM ELRKVASAIE EAALHPSELL
2760 2770 2780 2790 2800
TNMEDEDDTD ETLTSLLNEI AFLNQQLNDD SGLAELSGSM DTEFSGDAQR
2810 2820 2830 2840 2850
AFISKLAPGN RSAFQVGHLG AGVKELPDVQ EESESISPLL LHLEDDDFSE
2860 2870 2880 2890 2900
NEKQLGDTAS EPDVLKIVID PEIKDSLVSH RKSSDGGQST SGLPAEPESV
2910 2920 2930 2940 2950
SSPPILHMKT GPENSNTDTL WRPMPKLAPL GLKVANPPSD ADGQSLKVMP
2960 2970 2980 2990 3000
ALAPIAAKVG SIGHKMNLAG IDQEGRGSKV MPTLAPVVPK LGNSGAPSSS

SGK
Length:3,003
Mass (Da):328,802
Last modified:February 20, 2007 - v1
Checksum:iC0963FF86506A75C
GO
Isoform 2 (identifier: A2AWL7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1214-1214: Missing.
     1521-1728: Missing.
     1754-1754: L → LLIPVQQGSPTLRPIQNPQLQGQRMVLQPVRGPSGMNLFR
     2466-3003: Missing.

Note: No experimental confirmation available.
Show »
Length:2,295
Mass (Da):254,418
Checksum:i844E7A68DC01D030
GO
Isoform 3 (identifier: A2AWL7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     727-805: Missing.

Note: No experimental confirmation available.
Show »
Length:2,924
Mass (Da):320,326
Checksum:i8791B93D795EDAC1
GO
Isoform 4 (identifier: A2AWL7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-671: EAL → VWL
     672-3003: Missing.

Note: No experimental confirmation available.
Show »
Length:671
Mass (Da):75,270
Checksum:i26ACF8D2B46E46D1
GO

Sequence cautioni

The sequence BAD32240.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti11 – 111N → T in AAF24761 (PubMed:10601024).Curated
Sequence conflicti195 – 1951H → Y in BAC27930 (PubMed:16141072).Curated
Sequence conflicti217 – 2171Q → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti342 – 3421H → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti346 – 3461Q → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti349 – 3491H → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti359 – 3591S → R in AAF24761 (PubMed:10601024).Curated
Sequence conflicti403 – 4031Q → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti458 – 4581K → R in BAC32658 (PubMed:16141072).Curated
Sequence conflicti634 – 6341T → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti666 – 6661E → D in AAF24761 (PubMed:10601024).Curated
Sequence conflicti752 – 7521A → G in AAF24761 (PubMed:10601024).Curated
Sequence conflicti757 – 7571F → L in AAF24761 (PubMed:10601024).Curated
Sequence conflicti844 – 8441N → D in AAF24761 (PubMed:10601024).Curated
Sequence conflicti873 – 8731S → C in AAF24761 (PubMed:10601024).Curated
Sequence conflicti903 – 9031T → A in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1061 – 10611E → D in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1136 – 11361K → E in BAD32240 (PubMed:15368895).Curated
Sequence conflicti1191 – 11911S → ST in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1593 – 15931P → L in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1753 – 17553LLH → FDVG in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1763 – 17631L → F in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1826 – 18261S → P in AAF24761 (PubMed:10601024).Curated
Sequence conflicti1845 – 18451F → L in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2033 – 20331V → A in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2043 – 20431M → I in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2478 – 24781C → G in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2800 – 28023RAF → ARLI in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2809 – 28091G → V in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2814 – 28141F → Y in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2819 – 28213LGA → MGT in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2830 – 28301Q → L in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2835 – 28351S → T in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2852 – 28532EK → VR in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2865 – 28651L → H in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2877 – 28771L → R in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2928 – 29281A → T in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2969 – 29691A → T in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2971 – 29711I → S in AAF24761 (PubMed:10601024).Curated
Sequence conflicti2998 – 29981S → L in AAF24761 (PubMed:10601024).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei669 – 6713EAL → VWL in isoform 4. 1 PublicationVSP_034536
Alternative sequencei672 – 30032332Missing in isoform 4. 1 PublicationVSP_034537Add
BLAST
Alternative sequencei727 – 80579Missing in isoform 3. 1 PublicationVSP_034538Add
BLAST
Alternative sequencei1214 – 12141Missing in isoform 2. 1 PublicationVSP_034539
Alternative sequencei1521 – 1728208Missing in isoform 2. 1 PublicationVSP_034540Add
BLAST
Alternative sequencei1754 – 17541L → LLIPVQQGSPTLRPIQNPQL QGQRMVLQPVRGPSGMNLFR in isoform 2. 1 PublicationVSP_034541
Alternative sequencei2466 – 3003538Missing in isoform 2. 1 PublicationVSP_034542Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF205935 mRNA. Translation: AAF24761.1.
AK032570 mRNA. Translation: BAC27930.1.
AK046252 mRNA. Translation: BAC32658.1.
AK133775 mRNA. Translation: BAE21832.1.
AK162302 mRNA. Translation: BAE36840.1.
AL954662 Genomic DNA. Translation: CAM21730.1.
AL954662 Genomic DNA. Translation: CAM21731.1.
AK172962 mRNA. Translation: BAD32240.1. Different initiation.
RefSeqiNP_038748.2. NM_013720.2.
UniGeneiMm.437053.
Mm.87532.

Genome annotation databases

EnsembliENSMUST00000046717; ENSMUSP00000043795; ENSMUSG00000033943. [A2AWL7-1]
ENSMUST00000110773; ENSMUSP00000106400; ENSMUSG00000033943. [A2AWL7-3]
ENSMUST00000156510; ENSMUSP00000119044; ENSMUSG00000033943. [A2AWL7-2]
GeneIDi29808.
KEGGimmu:29808.
UCSCiuc008lur.1. mouse. [A2AWL7-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF205935 mRNA. Translation: AAF24761.1.
AK032570 mRNA. Translation: BAC27930.1.
AK046252 mRNA. Translation: BAC32658.1.
AK133775 mRNA. Translation: BAE21832.1.
AK162302 mRNA. Translation: BAE36840.1.
AL954662 Genomic DNA. Translation: CAM21730.1.
AL954662 Genomic DNA. Translation: CAM21731.1.
AK172962 mRNA. Translation: BAD32240.1. Different initiation.
RefSeqiNP_038748.2. NM_013720.2.
UniGeneiMm.437053.
Mm.87532.

3D structure databases

ProteinModelPortaliA2AWL7.
SMRiA2AWL7. Positions 75-259.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi205889. 6 interactions.
IntActiA2AWL7. 5 interactions.
STRINGi10090.ENSMUSP00000106401.

PTM databases

iPTMnetiA2AWL7.
PhosphoSiteiA2AWL7.

Proteomic databases

EPDiA2AWL7.
MaxQBiA2AWL7.
PaxDbiA2AWL7.
PRIDEiA2AWL7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000046717; ENSMUSP00000043795; ENSMUSG00000033943. [A2AWL7-1]
ENSMUST00000110773; ENSMUSP00000106400; ENSMUSG00000033943. [A2AWL7-3]
ENSMUST00000156510; ENSMUSP00000119044; ENSMUSG00000033943. [A2AWL7-2]
GeneIDi29808.
KEGGimmu:29808.
UCSCiuc008lur.1. mouse. [A2AWL7-4]

Organism-specific databases

CTDi23269.
MGIiMGI:1352483. Mga.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3585. Eukaryota.
ENOG410XSTS. LUCA.
GeneTreeiENSGT00740000115029.
HOVERGENiHBG108131.
InParanoidiA2AWL7.
OrthoDBiEOG7S7SCT.
PhylomeDBiA2AWL7.

Miscellaneous databases

ChiTaRSiMga. mouse.
PROiA2AWL7.
SOURCEiSearch...

Gene expression databases

BgeeiA2AWL7.
ExpressionAtlasiA2AWL7. baseline and differential.
GenevisibleiA2AWL7. MM.

Family and domain databases

Gene3Di2.60.40.820. 1 hit.
4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR032060. DUF4801.
IPR008967. p53-like_TF_DNA-bd.
IPR001699. TF_T-box.
IPR018186. TF_T-box_CS.
[Graphical view]
PANTHERiPTHR11267. PTHR11267. 1 hit.
PfamiPF16059. DUF4801. 1 hit.
PF00010. HLH. 1 hit.
PF00907. T-box. 1 hit.
[Graphical view]
PRINTSiPR00937. TBOX.
SMARTiSM00353. HLH. 1 hit.
SM00425. TBOX. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
SSF49417. SSF49417. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
PS01264. TBOX_2. 1 hit.
PS50252. TBOX_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Mga, a dual-specificity transcription factor that interacts with Max and contains a T-domain DNA-binding motif."
    Hurlin P.J., Steingrimsson E., Copeland N.G., Jenkins N.A., Eisenman R.N.
    EMBO J. 18:7019-7028(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1129 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1129 (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Colon, Corpora quadrigemina, Embryo and Olfactory bulb.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
    DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-2465 (ISOFORM 2).
    Tissue: Thymus.

Entry informationi

Entry nameiMGAP_MOUSE
AccessioniPrimary (citable) accession number: A2AWL7
Secondary accession number(s): A2AWL6
, Q3TS36, Q6A056, Q8BQX1, Q8CCL4, Q9QXJ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: February 20, 2007
Last modified: June 8, 2016
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.